| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-HCG monoclonal antibody (ZR362) 6210
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to HCG
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Placenta or choriocarcinoma
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-HCG monoclonal antibody ZR362 6210
| target relevance |
|---|
| Homo sapiens CGB3 Choriogonadotropin subunit beta 3 |
| Protein names Choriogonadotropin subunit beta 3 |
| Alternative names Choriogonadotropin subunit beta, Chorionic gonadotropin chain beta |
| Gene names CGB3 |
| Protein family Belongs to the glycoprotein hormones subunit beta family |
| Function Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin hormones (LH, FSH and TSH). The beta subunits are distinct in each of the hormones and confer receptor and biological specificity. Has an essential role in pregnancy and maternal adaptation. Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy |
| Subcellular location Secreted |
| Structure Heterodimer of a common alpha chain identical in LH, FSH, TSH and HCG and a unique beta chain distinct in each of the hormones |
| Keywords 3D-structure, Alternative splicing, Direct protein sequencing, Disulfide bond, Glycoprotein, Hormone, Pharmaceutical, Reference proteome, Secreted, Signal |
| Sequence MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| UniProt accession: P0DN86 |
Data
 |
| Formalin-fixed, paraffin-embedded human placenta stained with anti-HCG-beta antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of trophoblasts |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-HCG monoclonal antibody (ZR362) validated for?
This antibody is validated for immunohistochemistry (IHC) applications, specifically using formalin-fixed, paraffin-embedded human tissues.
How should the rabbit anti-HCG monoclonal antibody be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, store it at -20°C while avoiding repeated freeze/thaw cycles.
What species does the rabbit anti-HCG monoclonal antibody react with, and what is the recommended positive control?
The antibody reacts with human HCG protein and is recommended to be validated using placenta or choriocarcinoma tissue as positive controls.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.