Immunohistochemistry (IHC) : Human liver infected by hepatitis B virus stained with anti-HBsAg antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of infected hepatocytes.

rabbit anti-HBsAg monoclonal antibody (ZR393) 6209

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Hepatitis B Virus (HBV) HBsAg
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Hepatitis B infected liver
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6209parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, HBsAg, Infectious Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-HBsAg monoclonal antibody ZR393 6209

antibody
https://www.uniprot.org/uniprotkb/Q76R62/
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Hepatitis B infected liver
Immunogen Recombinant full-length HBsAg protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Hepatitis B virus genotype C subtype ayr (isolate Human/Japan/Okamoto/-) S Large envelope protein
Protein names Large envelope protein
Alternative names L glycoprotein, L-HBsAg, Large S protein, Large surface protein, Major surface antigen
Gene names S
Protein family Belongs to the orthohepadnavirus major surface antigen family
Function The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. This attachment induces virion internalization predominantly through caveolin-mediated endocytosis. The large envelope protein also assures fusion between virion membrane and endosomal membrane. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein
Subcellular location Virion membrane
Structure Interacts with isoform L. Interacts with the antigens of satellite virus HDV (HDVAgs); this interaction is required for encapsidation of HDV genomic RNA
Post-translational modification Isoform M is N-terminally acetylated by host at a ratio of 90%, and N-glycosylated by host at the pre-S2 region Myristoylated
Keywords 3D-structure, Acetylation, Alternative initiation, Alternative splicing, Caveolin-mediated endocytosis of virus by host, Fusion of virus membrane with host endosomal membrane, Fusion of virus membrane with host membrane, Glycoprotein, Host-virus interaction, Lipoprotein, Membrane, Myristate, Reference proteome, Transmembrane, Transmembrane helix, Viral attachment to host cell, Viral envelope protein, Viral penetration into host cytoplasm, Virion, Virus endocytosis by host, Virus entry into host cell
Sequence MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGA GAFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAM QWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTS GFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTI PAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL SPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
UniProt accession: Q76R62

Data

Human liver infected by hepatitis B virus stained with anti-HBsAg antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of infected hepatocytes.

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the rabbit anti-HBsAg monoclonal antibody (ZR393)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues with a recommended dilution of 1:100-200 when used in concentrated form.

How should the rabbit anti-HBsAg monoclonal antibody (ZR393) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Which species does the rabbit anti-HBsAg monoclonal antibody (ZR393) react with and what is its host and clonality?

The antibody is reactive with human samples. It is a rabbit monoclonal antibody with an IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.