| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | GSK3-α (Phospho-Ser21) |
| available sizes | 100 µL |
rabbit anti-GSK3-α (Phospho-Ser21) polyclonal antibody 1522
$366.00
Antibody summary
- Rabbit polyclonal to GSK3-α (Phospho-Ser21)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-GSK3-α (Phospho-Ser21) polyclonal antibody 1522
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Western blotting: use at dilution of 1:500- 1:1,000. A band of ~51kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 21 (T-S-S(p)-F-A) derived from human GSK3a and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens GSK3A Glycogen synthase kinase-3 alpha |
| Protein names Glycogen synthase kinase-3 alpha |
| Alternative names Serine/threonine-protein kinase GSK3A |
| Gene names GSK3A |
| Protein family Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. GSK-3 subfamily |
| Function Constitutively active protein kinase that acts as a negative regulator in the hormonal control of glucose homeostasis, Wnt signaling and regulation of transcription factors and microtubules, by phosphorylating and inactivating glycogen synthase (GYS1 or GYS2), CTNNB1/beta-catenin, APC and AXIN1 (PubMed:11749387, PubMed:17478001, PubMed:19366350). Requires primed phosphorylation of the majority of its substrates (PubMed:11749387, PubMed:17478001, PubMed:19366350). Contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis (PubMed:11749387, PubMed:17478001, PubMed:19366350). Regulates glycogen metabolism in liver, but not in muscle (By similarity). May also mediate the development of insulin resistance by regulating activation of transcription factors (PubMed:10868943, PubMed:17478001). In Wnt signaling, regulates the level and transcriptional activity of nuclear CTNNB1/beta-catenin (PubMed:17229088). Facilitates amyloid precursor protein (APP) processing and the generation of APP-derived amyloid plaques found in Alzheimer disease (PubMed:12761548). May be involved in the regulation of replication in pancreatic beta-cells (By similarity). Is necessary for the establishment of neuronal polarity and axon outgrowth (By similarity). Through phosphorylation of the anti-apoptotic protein MCL1, may control cell apoptosis in response to growth factors deprivation (By similarity). Acts as a regulator of autophagy by mediating phosphorylation of KAT5/TIP60 under starvation conditions which activates KAT5/TIP60 acetyltransferase activity and promotes acetylation of key autophagy regulators, such as ULK1 and RUBCNL/Pacer (PubMed:30704899). Negatively regulates extrinsic apoptotic signaling pathway via death domain receptors. Promotes the formation of an anti-apoptotic complex, made of DDX3X, BRIC2 and GSK3B, at death receptors, including TNFRSF10B. The anti-apoptotic function is most effective with weak apoptotic signals and can be overcome by stronger stimulation (By similarity). Phosphorylates mTORC2 complex component RICTOR at 'Thr-1695' which facilitates FBXW7-mediated ubiquitination and subsequent degradation of RICTOR (PubMed:25897075) |
| Catalytic activity L-seryl-[tau protein] + ATP = O-phospho-L-seryl-[tau protein] + ADP + H(+) L-threonyl-[tau protein] + ATP = O-phospho-L-threonyl-[tau protein] + ADP + H(+) L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Structure (Microbial infection) Interacts with M.tuberculosis PtpA |
| Post-translational modification Phosphorylated by AKT1 at Ser-21: upon insulin-mediated signaling, the activated PKB/AKT1 protein kinase phosphorylates and deactivates GSK3A, resulting in the dephosphorylation and activation of GYS1. Activated by phosphorylation at Tyr-279 (Microbial infection) Dephosphorylated at Tyr-279 by M.tuberculosis PtpA, which leads to prevention of apoptosis during early stages of microbial infection |
| Keywords 3D-structure, Acetylation, Alzheimer disease, ATP-binding, Carbohydrate metabolism, Diabetes mellitus, Glycogen metabolism, Kinase, Neurogenesis, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Signal transduction inhibitor, Transferase, Wnt signaling pathway |
| Sequence MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT NSS |
| UniProt accession: P49840 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution for using this rabbit anti-GSK3-α (Phospho-Ser21) polyclonal antibody in Western blotting?
For Western blotting applications, it is recommended to use this antibody at a dilution range of 1:500 to 1:1,000. A band of approximately 51 kDa is typically detected at these dilutions.
How should this antibody be stored to maintain its stability?
This antibody should be stored at -20°C, where it remains stable for at least one year. It is supplied in PBS buffer without magnesium and calcium ions, at pH 7.4 with 150 mM NaCl.
What type of immunogen was used to generate this rabbit polyclonal antibody against GSK3-α (Phospho-Ser21)?
The immunogen used is a peptide sequence including the phosphorylation site at Serine 21 (T-S-S(p)-F-A) derived from human GSK3α, conjugated to keyhole limpet hemocyanin (KLH).
Which secondary antibodies are compatible with this rabbit anti-GSK3-α (Phospho-Ser21) polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG antibodies that are H&L chain specific and conjugated to peroxidase, biotin, FITC, or are cross-absorbed variants to reduce cross-reactivity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.