| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | GFRα-3 |
| available sizes | 100 µg |
rabbit anti-GFR-3 (IN) polyclonal antibody 7986
$445.00
Antibody summary
- Rabbit polyclonal to GFR-3 (IN)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-GFR-3 (IN) polyclonal antibody 7986
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. Positive control: Tissue lysates of mouse kidney, liver, or heart. |
| Immunogen Peptide corresponding to aa 347- 360 of mouse GFRa-3. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity protein affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus GFRA3 GDNF family receptor alpha-3 |
| Protein names GDNF family receptor alpha-3 |
| Gene names Gfra3 |
| Protein family Belongs to the GDNFR family |
| Function Receptor for artemin (ARTN), a growth factor that supports the survival of sensory and sympathetic peripheral neurons. ARTN-binding leads to autophosphorylation and activation of the RET receptor |
| Subcellular location Cell membrane |
| Structure Interacts with ARTN ligand and RET: forms a 2:2:2 ternary complex composed of ARTN ligand, GFRA3 and RET receptor. Interacts with SORL1 |
| Keywords Cell membrane, Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Membrane, Receptor, Reference proteome, Signal |
| Sequence MGLSWSPRPPLLMILLLVLSLWLPLGAGNSLATENRFVNSCTQARKKCEANPACKAAYQH LGSCTSSLSRPLPLEESAMSADCLEAAEQLRNSSLIDCRCHRRMKHQATCLDIYWTVHPA RSLGDYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLHDKCDRLRKAYG EACSGIRCQRHLCLAQLRSFFEKAAESHAQGLLLCPCAPEDAGCGERRRNTIAPSCALPS VTPNCLDLRSFCRADPLCRSRLMDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPN FISKVNTTVALSCTCRGSGNLQDECEQLERSFSQNPCLVEAIAAKMRFHRQLFSQDWADS TFSVVQQQNSNPALRLQPRLPILSFSILPLILLQTLW |
| UniProt accession: O35118 |
Data
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-GFR-3 (IN) polyclonal antibody suitable for?
This antibody is suitable for ELISA, Western blot (WB), immunohistochemistry on paraffin-embedded tissue (IHC-P), and immunofluorescence (IF).
How should the rabbit anti-GFR-3 (IN) polyclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve its integrity.
What is the immunogen used to generate this rabbit anti-GFR-3 antibody?
The immunogen is a peptide corresponding to amino acids 347 to 360 of the mouse GFRα-3 protein.
Which secondary antibodies are compatible with this rabbit anti-GFR-3 (IN) polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG antibodies that are H&L chain specific and conjugated with peroxidase, biotin, or FITC, including both standard and cross-absorbed polyclonal antibodies.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.















Reviews
There are no reviews yet.