| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | GFRα-2 |
| available sizes | 100 µg |
rabbit anti-GFR-2 (IN) polyclonal antibody 9346
$445.00
Antibody summary
- Rabbit polyclonal to GFR-2 (IN)
- Suitable for: ELISA,WB,ICC
- Isotype: IgG
- 100 µg
rabbit anti-GFR-2 (IN) polyclonal antibody 9346
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:1,000-1:2,000 dilution. Positive control: Whole cell lysate of HeLa cells. |
| Immunogen Peptide corresponding to aa 377- 391 of human GFRa-2. This peptide sequence is identical to those of mouse and rat. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens GFRA2 GDNF family receptor alpha-2 |
| Protein names GDNF family receptor alpha-2 |
| Alternative names GDNF receptor beta, Neurturin receptor alpha, RET ligand 2, TGF-beta-related neurotrophic factor receptor 2 |
| Gene names GFRA2 |
| Protein family Belongs to the GDNFR family |
| Function Receptor for neurturin (NRTN), a growth factor that supports the survival of sympathetic neurons (PubMed:10829012, PubMed:29414779, PubMed:31535977, PubMed:9182803). NRTN-binding leads to autophosphorylation and activation of the RET receptor (PubMed:31535977). Also able to mediate GDNF signaling through the RET tyrosine kinase receptor (PubMed:9182803) |
| Subcellular location Cell membrane |
| Structure Interacts with NRTN ligand and RET: forms a 2:2:2 ternary complex composed of NRTN ligand, GFRA2 and RET receptor (PubMed:31535977). Also forms a 4:4:4 tetrameric complex composed of 4 copies of NRTN ligand, GFRA2 and RET receptor, which prevents endocytosis of RET (PubMed:31535977). Interacts with SORL1 (PubMed:23333276) |
| Keywords 3D-structure, Alternative splicing, Cell membrane, Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Signal |
| Sequence MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTL RQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGE EFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSS YISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS CSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGM IGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTD VNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSM CFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL |
| UniProt accession: O00451 |
Data
![]() |
| Western blot analysis of GFR alpha 2 in HeLa total cell lysate with GFR alpha 2 antibody at 1 µg/mL. |
![]() |
| Immunocytochemistry of GFR alpha 2 in HeLa cells with GFR alpha 2 antibody at 5 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-GFR-2 (IN) polyclonal antibody 9346 validated for?
This antibody has been tested and is suitable for ELISA, Western Blot (WB), and Immunocytochemistry/Immunofluorescence (ICC/IF) applications.
How should the rabbit anti-GFR-2 (IN) polyclonal antibody 9346 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.











Reviews
There are no reviews yet.