Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human brain stained with anti-GFAP antibody using peroxidase-conjugate and DAB chromogen. Note positive staining of astrocytic processes

rabbit anti-GFAP monoclonal antibody ZR356 6193

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to GFAP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Brain or astrocytoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6193parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, GFAP, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-GFAP monoclonal antibody ZR356 6193

antibody
Database link: human P14136
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Brain or astrocytoma
Immunogen Recombinant fragment (around aa 150-250) of human GFAP protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens GFAP Glial fibrillary acidic protein
Protein names Glial fibrillary acidic protein
Gene names GFAP
Protein family Belongs to the intermediate filament family
Function GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells
Subcellular location Cytoplasm
Structure Interacts with PSEN1 (via N-terminus)
Post-translational modification Phosphorylated by PKN1
Involvement in disease Alexander disease A rare disorder of the central nervous system. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death within the first decade. Infants with Alexander disease develop a leukodystrophy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course. Histologically, Alexander disease is characterized by Rosenthal fibers, homogeneous eosinophilic inclusions in astrocytes.
Keywords 3D-structure, Alternative splicing, Citrullination, Coiled coil, Cytoplasm, Direct protein sequencing, Disease variant, Intermediate filament, Leukodystrophy, Methylation, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM
UniProt accession: P14136

Data

Formalin-fixed, paraffin-embedded human brain stained with anti-GFAP antibody using peroxidase-conjugate and DAB chromogen. Note positive staining of astrocytic processes

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-GFAP monoclonal antibody ZR356 6193 react with?

This antibody reacts specifically with human GFAP protein.

For which application is the rabbit anti-GFAP monoclonal antibody ZR356 6193 primarily recommended?

The antibody is suitable and recommended for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the storage conditions for maintaining the stability of this GFAP antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles.

What is the host and clonality of the anti-GFAP antibody ZR356 6193?

The antibody is a rabbit monoclonal antibody with an IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.