Immunohistochemistry (IHC) : Human brain stained with anti-GFAP antibody using peroxidase-conjugate and DAB chromogen. Note positive staining of astrocytic processes.

mouse anti-GFAP monoclonal antibody GA-5 6194

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to GFAP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Brain or astrocytoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6194parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, GFAP, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-GFAP monoclonal antibody GA-5 6194

antibody
Database link: human P14136
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Brain or astrocytoma
Immunogen Native GFAP purified from pig spinal cord
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens GFAP Glial fibrillary acidic protein
Protein names Glial fibrillary acidic protein
Gene names GFAP
Protein family Belongs to the intermediate filament family
Function GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells
Subcellular location Cytoplasm
Structure Interacts with PSEN1 (via N-terminus)
Post-translational modification Phosphorylated by PKN1
Involvement in disease Alexander disease A rare disorder of the central nervous system. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death within the first decade. Infants with Alexander disease develop a leukodystrophy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course. Histologically, Alexander disease is characterized by Rosenthal fibers, homogeneous eosinophilic inclusions in astrocytes.
Keywords 3D-structure, Alternative splicing, Citrullination, Coiled coil, Cytoplasm, Direct protein sequencing, Disease variant, Intermediate filament, Leukodystrophy, Methylation, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM
UniProt accession: P14136

Data

Human brain stained with anti-GFAP antibody using peroxidase-conjugate and DAB chromogen. Note positive staining of astrocytic processes.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-GFAP monoclonal antibody GA-5 6194 react with?

This antibody reacts specifically with human GFAP (glial fibrillary acidic protein).

What applications is this anti-GFAP antibody suitable for?

It is suitable for immunohistochemistry (IHC), particularly on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-GFAP monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, avoiding freeze-thaw cycles to preserve antibody integrity.

What is the recommended dilution range for using the concentrated form of this GFAP antibody in IHC?

The concentrated antibody is recommended to be diluted between 1:100 and 1:200 for immunohistochemistry applications.

What type of control tissue is recommended when using this antibody for IHC?

Brain tissue or astrocytoma samples are recommended as positive controls for validating staining with this GFAP antibody.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.