Skip to content

rabbit anti-GATA1 (phospho-Ser310) polyclonal antibody 8063

$366.00

Antibody summary

  • Rabbit polyclonal to GATA1 (phospho-Ser310)
  • Suitable for: WB,IF
  • Isotype: Whole IgG
  • 100 µl
SKU: 8063parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

GATA1 (phospho-Ser310)

available sizes

100 µL

rabbit anti-GATA1 (phospho-Ser310) polyclonal antibody 8063

antibody
Tested applications
WB,ICC/IF
Recommended dilutions
Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~43kDa is detected.

Immunofluorescence: use at dilution of 1:100-1:200.

These are recommended working dilutions.

End user should determine optimal dilutions for their applications
Immunogen
Peptide sequence that includes phosphorylation site of Serine 310 (K-A-S(p)-G-K) derived from human GATA1 and conjugated to KLH.
Size and concentration
100µL and 1 mg/mL
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C.
Storage buffer
PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl,
Purity
affinity purified
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens GATA1
Erythroid transcription factor
Protein names
Erythroid transcription factor
Alternative names
Eryf1, GATA-binding factor 1, NF-E1 DNA-binding protein
Gene names
GATA1
Function
Transcriptional activator or repressor which serves as a general switch factor for erythroid development (PubMed:35030251). It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of globin genes and of other genes expressed in erythroid cells. Activates the transcription of genes involved in erythroid differentiation of K562 erythroleukemia cells, including HBB, HBG1/2, ALAS2 and HMBS (PubMed:24245781)
Subcellular location
Nucleus
Structure
May form homodimers or heterodimers with other isoforms. Interacts (via the N-terminal zinc finger) with ZFPM1. Interacts with GFI1B. Interacts with PIAS4; the interaction enhances sumoylation and represses the transactivational activity in a sumoylation-independent manner. Interacts with LMCD1. Interacts with BRD3 (By similarity). Interacts with CREBBP; the interaction stimulates acetylation and transcriptional activity in vivo (By similarity). Interacts with EP300. Interacts with MED1, CCAR1 and CALCOCO1. Interacts with CEBPE (PubMed:26019275)
Post-translational modification
Highly phosphorylated on serine residues. Phosphorylation on Ser-310 is enhanced on erythroid differentiation. Phosphorylation on Ser-142 promotes sumoylation on Lys-137 (By similarity)
Sumoylation on Lys-137 is enhanced by phosphorylation on Ser-142 and by interaction with PIAS4. Sumoylation with SUMO1 has no effect on transcriptional activity (By similarity)
Acetylated at 2 conserved lysine-rich motifs by CREBBP in vitro. Acetylation does not affect DNA-binding in vitro but is essential to induce erythroid differentiation and for binding chromatin in vivo (By similarity). Acetylated on Lys-233, Lys-245 Lys-246 by EP300
Involvement in disease
X-linked dyserythropoietic anemia and thrombocytopenia
Disorder characterized by erythrocytes with abnormal size and shape, and paucity of platelets in peripheral blood. The bone marrow contains abundant and abnormally small megakaryocytes.

Thrombocytopenia with beta-thalassemia, X-linked
An unusual form of thrombocytopenia associated with beta-thalassemia. Patients have splenomegaly and petechiae, moderate thrombocytopenia, prolonged bleeding time due to platelet dysfunction, reticulocytosis and unbalanced (hemo)globin chain synthesis resembling that of beta-thalassemia minor.

Anemia without thrombocytopenia, X-linked
A form of anemia characterized by abnormal morphology of erythrocytes and granulocytes in peripheral blood, bone marrow dysplasia with hypocellularity of erythroid and granulocytic lineages, and normal or increased number of megakaryocytes. Neutropenia of a variable degree is present in affected individuals.

Anemia, congenital, non-spherocytic hemolytic, 9
An X-linked disorder characterized by onset of mild to moderate red cell anemia soon after birth or in childhood. The anemia is associated with significantly increased adenosine deaminase activity, specifically in erythrocyte precursors.

Keywords
3D-structure, Acetylation, Activator, Alternative initiation, Alternative splicing, Direct protein sequencing, Disease variant, DNA-binding, Hereditary hemolytic anemia, Isopeptide bond, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Repressor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger
Sequence
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS
UniProt accession: P15976

Data

No results found

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-GATA1 (phospho-Ser310) polyclonal antibody 8063 validated for?
This antibody is validated for use in Western blot (WB) and immunofluorescence (IF/ICC) applications.
How should the rabbit anti-GATA1 (phospho-Ser310) antibody be stored to ensure stability?
The antibody should be stored at -20°C, where it remains stable for at least one year.
What is the recommended dilution range for using this antibody in Western blot experiments?
For immunoblotting, a dilution of 1:500 to 1:1,000 is recommended, detecting a band at approximately 43 kDa.
What is the immunogen used to generate the rabbit anti-GATA1 (phospho-Ser310) polyclonal antibody?
The immunogen is a peptide sequence including the phosphorylation site at serine 310 (K-A-S(p)-G-K) derived from human GATA1 and conjugated to KLH.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.