| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | GATA1 (phospho-Ser142) |
| available sizes | 100 µL |
rabbit anti-GATA1 (phospho-Ser142) polyclonal antibody 7648
$366.00
Antibody summary
- Rabbit polyclonal to GATA1 (phospho-Ser142)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-GATA1 (phospho-Ser142) polyclonal antibody 7648
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~43kDa is detected. Immunohistochemistry: use at dilution of 1:50-1:100. These are recommended working dilutions. End user should determine optimal dilutions for their applications |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 142 (R-L-S(p)-P-D) derived from human GATA1 and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens GATA1 Erythroid transcription factor |
| Protein names Erythroid transcription factor |
| Alternative names Eryf1, GATA-binding factor 1, NF-E1 DNA-binding protein |
| Gene names GATA1 |
| Function Transcriptional activator or repressor which serves as a general switch factor for erythroid development (PubMed:35030251). It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of globin genes and of other genes expressed in erythroid cells. Activates the transcription of genes involved in erythroid differentiation of K562 erythroleukemia cells, including HBB, HBG1/2, ALAS2 and HMBS (PubMed:24245781) |
| Subcellular location Nucleus |
| Structure May form homodimers or heterodimers with other isoforms. Interacts (via the N-terminal zinc finger) with ZFPM1. Interacts with GFI1B. Interacts with PIAS4; the interaction enhances sumoylation and represses the transactivational activity in a sumoylation-independent manner. Interacts with LMCD1. Interacts with BRD3 (By similarity). Interacts with CREBBP; the interaction stimulates acetylation and transcriptional activity in vivo (By similarity). Interacts with EP300. Interacts with MED1, CCAR1 and CALCOCO1. Interacts with CEBPE (PubMed:26019275) |
| Post-translational modification Highly phosphorylated on serine residues. Phosphorylation on Ser-310 is enhanced on erythroid differentiation. Phosphorylation on Ser-142 promotes sumoylation on Lys-137 (By similarity) Sumoylation on Lys-137 is enhanced by phosphorylation on Ser-142 and by interaction with PIAS4. Sumoylation with SUMO1 has no effect on transcriptional activity (By similarity) Acetylated at 2 conserved lysine-rich motifs by CREBBP in vitro. Acetylation does not affect DNA-binding in vitro but is essential to induce erythroid differentiation and for binding chromatin in vivo (By similarity). Acetylated on Lys-233, Lys-245 Lys-246 by EP300 |
| Involvement in disease X-linked dyserythropoietic anemia and thrombocytopenia Disorder characterized by erythrocytes with abnormal size and shape, and paucity of platelets in peripheral blood. The bone marrow contains abundant and abnormally small megakaryocytes. Thrombocytopenia with beta-thalassemia, X-linked An unusual form of thrombocytopenia associated with beta-thalassemia. Patients have splenomegaly and petechiae, moderate thrombocytopenia, prolonged bleeding time due to platelet dysfunction, reticulocytosis and unbalanced (hemo)globin chain synthesis resembling that of beta-thalassemia minor. Anemia without thrombocytopenia, X-linked A form of anemia characterized by abnormal morphology of erythrocytes and granulocytes in peripheral blood, bone marrow dysplasia with hypocellularity of erythroid and granulocytic lineages, and normal or increased number of megakaryocytes. Neutropenia of a variable degree is present in affected individuals. Anemia, congenital, non-spherocytic hemolytic, 9 An X-linked disorder characterized by onset of mild to moderate red cell anemia soon after birth or in childhood. The anemia is associated with significantly increased adenosine deaminase activity, specifically in erythrocyte precursors. |
| Keywords 3D-structure, Acetylation, Activator, Alternative initiation, Alternative splicing, Direct protein sequencing, Disease variant, DNA-binding, Hereditary hemolytic anemia, Isopeptide bond, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Repressor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger |
| Sequence MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS |
| UniProt accession: P15976 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-GATA1 (phospho-Ser142) polyclonal antibody 7648 validated for?
This antibody is validated for use in Western blotting (WB) and immunohistochemistry (IHC). Recommended dilutions are 1:500-1:1,000 for immunoblotting and 1:50-1:100 for immunohistochemistry.
How should I store the rabbit anti-GATA1 (phospho-Ser142) polyclonal antibody to maintain its stability?
The antibody should be stored at -20°C where it remains stable for at least one year. It is supplied in PBS buffer without magnesium and calcium ions, at pH 7.4 with 150 mM NaCl.
What is the host species and clonality of this anti-GATA1 (phospho-Ser142) antibody?
This antibody is a rabbit polyclonal antibody of the IgG isotype.
What immunogen was used to generate the rabbit anti-GATA1 (phospho-Ser142) antibody?
The immunogen is a peptide sequence derived from human GATA1 containing the phosphorylation site at serine 142 (sequence R-L-S(p)-P-D) conjugated to KLH.
Is this antibody compatible with secondary antibodies for detection, and if so, which ones?
Yes, this antibody is compatible with various goat anti-rabbit IgG secondary antibodies including peroxidase conjugated, biotin conjugated, FITC conjugated, and cross-absorbed versions targeting the heavy and light chains.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.