| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | FLIPγ/δ (CT) |
| available sizes | 100 µg |
rabbit anti-FLIP (CT) polyclonal antibody 2874
$445.00
Antibody summary
- Rabbit polyclonal to FLIP (CT)
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-FLIP (CT) polyclonal antibody 2874
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting : use at 1ug/mL. Immunocytochemistry: use at 2ug/mL. Positive control: Whole cell lysate from HeLa, Jurkat,THP-1, A431, K562, or NIH3T3 cells. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 191-209 at the C-terminus of human FLIPdelta/FLIPS form (accession no. AAC51623). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CFLAR CASP8 and FADD-like apoptosis regulator |
| Protein names CASP8 and FADD-like apoptosis regulator |
| Alternative names Caspase homolog, Caspase-eight-related protein, Caspase-like apoptosis regulatory protein, Cellular FLICE-like inhibitory protein, FADD-like antiapoptotic molecule 1, Inhibitor of FLICE, MACH-related inducer of toxicity, Usurpin |
| Gene names CFLAR |
| Protein family Belongs to the peptidase C14A family |
| Function Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells (PubMed:31046799). Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity |
| Structure (Microbial infection) Interacts with HBV protein X |
| Post-translational modification Proteolytically processed by CASP8 generating subunit p43 and p12 Deubiquitinated by USP40, leading to stabilization |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Host-virus interaction, Proteomics identification, Reference proteome, Repeat |
| Sequence MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
| UniProt accession: O15519 |
Data
 |
| Western blot analysis of FLIP in total cell lysates from HeLa (H), Jurkat (J), THP-1 (T), A431 (A), K562 (K) and NIH3T3 (N) cells with FLIP antibody at 1:1000 dilution. |
 |
| Immunocytochemistry staining of HeLa cells using FLIP antibody at 2 µg/mL. |
 |
| Immunofluorescence of FLIP in HeLa cells with FLIP antibody at 10 µg/mL. |
 |
| Immunofluorescence of FLIP in Jurkat cells with FLIP antibody at 20 µg/mL.
Red: FLIP Antibody (2874) Blue: DAPI staining |
 |
| Immunocytochemistry of FLIP in Jurkat cells with FLIP antibody at 2 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-FLIP (CT) polyclonal antibody suitable for?
This antibody is suitable for ELISA, Western blot (WB), immunocytochemistry (ICC), and immunofluorescence (IF) applications.
How should the rabbit anti-FLIP (CT) polyclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year. Avoid multiple freeze-thaw cycles to preserve its integrity.
What is the recommended dilution for using this antibody in immunoblotting experiments?
For immunoblotting (Western blot), it is recommended to use the antibody at a concentration of 1 µg/mL.
Which species or cell lysates have been validated as positive controls for this antibody?
Positive controls include whole cell lysates from HeLa, Jurkat, THP-1, A431, K562, and NIH3T3 cells.
What is the immunogen used to raise this polyclonal antibody?
The immunogen is a peptide corresponding to amino acids 191-209 at the C-terminus of the human FLIPdelta/FLIPS form (accession no. AAC51623).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.