| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Ezrin (Phospho-Tyr353) |
| available sizes | 100 µL |
rabbit anti-Ezrin (Phospho-Tyr353) polyclonal antibody 1249
$366.00
Antibody summary
- Rabbit polyclonal to Ezrin (Phospho-Tyr353)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-Ezrin (Phospho-Tyr353) polyclonal antibody 1249
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~81kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their application. |
| Immunogen Peptide sequence that includes phosphorylation site of tyrosine 353 (Q-D-Y(p)-E-E) derived from human Ezrin and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens EZR Ezrin |
| Protein names Ezrin |
| Alternative names Cytovillin, Villin-2, p81 |
| Gene names EZR |
| Function Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis |
| Subcellular location Apical cell membrane, Cell projection, Cell projection, microvillus membrane, Cell projection, ruffle membrane, Cytoplasm, cell cortex, Cytoplasm, cytoskeleton, Cell projection, microvillus |
| Structure Monomer. Homodimer (PubMed:27364155). Interacts with PALS1 and NHERF2. Found in a complex with EZR, PODXL and NHERF2 (By similarity). Interacts with MCC, PLEKHG6, PODXL, SCYL3/PACE1, NHERF1 and TMEM8B (PubMed:12651155, PubMed:15498789, PubMed:17616675, PubMed:17881735, PubMed:19555689, PubMed:9314537). Interacts (when phosphorylated) with FES/FPS (PubMed:18046454). Interacts with dimeric S100P, the interaction may be activating through unmasking of F-actin binding sites (PubMed:12808036, PubMed:19111582). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (By similarity). Detected in a complex composed of at least EZR, AHNAK, PPL and PRX (By similarity). Interacts with PDPN (via cytoplasmic domain); activates RHOA and promotes epithelial-mesenchymal transition (PubMed:17046996). Interacts with SPN/CD43 cytoplasmic tail, CD44 and ICAM2 (By similarity). Interacts with SLC9A3; interaction targets SLC9A3 to the apical membrane (By similarity). Interacts with SLC9A1; regulates interactions of SLC9A1 with cytoskeletal and promotes stress fiber formation (By similarity). Interacts with CLIC5; may work together in a complex which also includes RDX and MYO6 to stabilize linkages between the plasma membrane and subjacent actin cytoskeleton at the base of stereocilia (By similarity) |
| Post-translational modification Phosphorylated by tyrosine-protein kinases. Phosphorylation by ROCK2 suppresses the head-to-tail association of the N-terminal and C-terminal halves resulting in an opened conformation which is capable of actin and membrane-binding (By similarity) S-nitrosylation is induced by interferon-gamma and oxidatively-modified low-densitity lipoprotein (LDL(ox)) possibly implicating the iNOS-S100A8/9 transnitrosylase complex |
| Keywords 3D-structure, Acetylation, Cell membrane, Cell projection, Cell shape, Coiled coil, Cytoplasm, Cytoskeleton, Direct protein sequencing, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, S-nitrosylation |
| Sequence MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL |
| UniProt accession: P15311 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Ezrin (Phospho-Tyr353) polyclonal antibody 1249 validated for?
This antibody is suitable for Western blot (WB), immunohistochemistry (IHC), and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should I store the rabbit anti-Ezrin (Phospho-Tyr353) polyclonal antibody to ensure stability?
Store the antibody at -20°C, where it remains stable for at least one year.
What is the recommended dilution range for using this antibody in immunoblotting and immunohistochemistry?
For immunoblotting, use a dilution between 1:500 and 1:1,000, which detects a band of approximately 81 kDa. For immunohistochemistry, use a dilution between 1:50 and 1:100. Optimal dilutions should be determined by the end user based on their specific application.
What is the immunogen used to generate the rabbit anti-Ezrin (Phospho-Tyr353) polyclonal antibody 1249?
The immunogen is a peptide sequence including the phosphorylated tyrosine 353 site (Q-D-Y(p)-E-E) derived from human Ezrin, conjugated to Keyhole Limpet Hemocyanin (KLH).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.