| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Estrogen Receptor-a (Phospho-Ser167) |
| available sizes | 100 µL |
rabbit anti-Estrogen Receptor-a (Phospho-Ser167) polyclonal antibody 2652
$366.00
Antibody summary
- Rabbit polyclonal to Estrogen Receptor-a (Phospho-Ser167)
- Suitable for: WB,IHC,IF
- Isotype: Whole IgG
- 100 µl
rabbit anti-Estrogen Receptor-a (Phospho-Ser167) polyclonal antibody 2652
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~66kDa is detected. Immunofluorescence: use at dilution of 1:100-1:200. Immunohistochemistry: use at dilution of 1:50-1:100. These are recommended working dilutions. End user should determine optimal dilution |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 167 (L-A-S(p)-T-N) derived from human estrogen receptor-a and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Thunnus thynnus ERA Estrogen receptor a |
| Gene names ERa |
| Protein family Belongs to the nuclear hormone receptor family. NR3 subfamily |
| Subcellular location Nucleus |
| Keywords DNA-binding, Lipid-binding, Metal-binding, Nucleus, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger |
| Sequence PATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGVRKDRGRVLRRDKRWTGTRDKSTKELE HRTVPPQDGRKRSSSSNSAGGGKSSIAGMPPDQVLLVLQGAEPPILCARQKMSRPYTEVT MMAMLTSMADKELVHMIAWAKKLPGFVQLSLHDQVQLLESAWLEVLMIGLMWRSIHCPGK LIFAQDLILDRDESTCVEGMAEIFDMLLATTSRFRLLKLKPEEFVCLKAIVLLNSGAFAF CTSTMEPLHDSTAVQIMLDTITDALVHYISQSGCTVQQQSRRQAQLLLLLTHIRHMSNKG MEHLYSIKCKNTVPLYDLLLEMLDAH |
| UniProt accession: G1E6Z3 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended dilutions for using the rabbit anti-Estrogen Receptor-a (Phospho-Ser167) antibody in Western blot, Immunofluorescence, and Immunohistochemistry?
For Western blotting, use a dilution of 1:500 to 1:1,000. For Immunofluorescence, use 1:100 to 1:200. For Immunohistochemistry, use 1:50 to 1:100. These are recommended starting dilutions, and the optimal dilution should be determined by the end user.
What is the host species and clonality of this Estrogen Receptor-a (Phospho-Ser167) antibody?
This antibody is a rabbit polyclonal antibody of the IgG isotype.
How should the rabbit anti-Estrogen Receptor-a (Phospho-Ser167) antibody be stored to maintain stability?
The antibody should be stored at -20°C, where it remains stable for at least one year.
What is the immunogen used to generate this rabbit anti-Estrogen Receptor-a (Phospho-Ser167) antibody?
The immunogen is a peptide sequence including the phosphorylation site of Serine 167 (L-A-S(p)-T-N) derived from human estrogen receptor-alpha and conjugated to KLH.
Which secondary antibodies are compatible with the rabbit anti-Estrogen Receptor-a (Phospho-Ser167) polyclonal antibody?
Compatible secondaries include goat anti-rabbit IgG antibodies that are H&L chain specific and conjugated to peroxidase, biotin, FITC, or cross-absorbed versions thereof.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.