| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Estrogen Receptor-a (Phospho-Ser106) |
| available sizes | 100 µL |
rabbit anti-Estrogen Receptor-a (Phospho-Ser106) polyclonal antibody 6321
$366.00
Antibody summary
- Rabbit polyclonal to Estrogen Receptor-a (Phospho-Ser106)
- Suitable for: WB,IHC,IF
- Isotype: Whole IgG
- 100 µl
rabbit anti-Estrogen Receptor-a (Phospho-Ser106) polyclonal antibody 6321
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~66kDa is detected. Immunofluorescence: use at dilution of 1:100-1:200. Immunohistochemistry: use at dilution of 1:50-1:100. These are recommended working dilutions. End user should determine optimal dilution |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 106 (S-P-S(p)-P-L) derived from human estrogen receptor-a and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Thunnus thynnus ERA Estrogen receptor a |
| Gene names ERa |
| Protein family Belongs to the nuclear hormone receptor family. NR3 subfamily |
| Subcellular location Nucleus |
| Keywords DNA-binding, Lipid-binding, Metal-binding, Nucleus, Receptor, Steroid-binding, Transcription, Transcription regulation, Zinc, Zinc-finger |
| Sequence PATNQCTIDRNRRKSCQACRLRKCYEVGMMKGGVRKDRGRVLRRDKRWTGTRDKSTKELE HRTVPPQDGRKRSSSSNSAGGGKSSIAGMPPDQVLLVLQGAEPPILCARQKMSRPYTEVT MMAMLTSMADKELVHMIAWAKKLPGFVQLSLHDQVQLLESAWLEVLMIGLMWRSIHCPGK LIFAQDLILDRDESTCVEGMAEIFDMLLATTSRFRLLKLKPEEFVCLKAIVLLNSGAFAF CTSTMEPLHDSTAVQIMLDTITDALVHYISQSGCTVQQQSRRQAQLLLLLTHIRHMSNKG MEHLYSIKCKNTVPLYDLLLEMLDAH |
| UniProt accession: G1E6Z3 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Estrogen Receptor-a (Phospho-Ser106) polyclonal antibody suitable for and what are the recommended dilutions?
This antibody is suitable for Western blotting (WB), immunohistochemistry (IHC), and immunofluorescence (IF). Recommended dilutions are 1:500-1:1,000 for Western blotting, 1:50-1:100 for immunohistochemistry, and 1:100-1:200 for immunofluorescence.
How should the rabbit anti-Estrogen Receptor-a (Phospho-Ser106) polyclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C where it remains stable for at least one year. It is supplied in PBS buffer without magnesium and calcium ions, at pH 7.4 with 150 mM NaCl.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.