| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | ESE-1 |
| available sizes | 100 µg |
rabbit anti-ESE-1 polyclonal antibody 2645
$376.00
Antibody summary
- Rabbit polyclonal to ESE-1
- Suitable for: WB,ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-ESE-1 polyclonal antibody 2645
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution ELISA: use at 1:1,000-1:5,000 dilution. |
| Immunogen N-terminal sequence MAATCEISNIFSNYFS and C-terminal sequence SSGWKEEEVLQSRN of human ESE-1 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens ELF3 ETS-related transcription factor Elf-3 |
| Protein names ETS-related transcription factor Elf-3 |
| Alternative names E74-like factor 3, Epithelial-restricted with serine box, Epithelium-restricted Ets protein ESX, Epithelium-specific Ets transcription factor 1 |
| Gene names ELF3 |
| Protein family Belongs to the ETS family |
| Function Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity) |
| Subcellular location Cytoplasm, Nucleus |
| Structure Interacts with TBP. Interacts with CREBBP and EP300; these act as transcriptional coactivators of ELF3 and positively modulate its function. Interacts with XRCC5/KU86 and XRCC6/KU70; these inhibit the ability of ELF3 to bind DNA and negatively modulate its transcriptional activity. Associated with CLND7 and POU2F3. Interacts with ZNF768 (PubMed:30476274) |
| Keywords 3D-structure, Activator, Alternative splicing, Cytoplasm, Developmental protein, Differentiation, DNA-binding, Inflammatory response, Nucleus, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation |
| Sequence MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG WKEEEVLQSRN |
| UniProt accession: P78545 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications and dilutions for the rabbit anti-ESE-1 polyclonal antibody 2645?
This antibody is suitable for Western Blot (WB) and ELISA applications. For immunoblotting, use at a dilution of 1:500 to 1:1,000. For ELISA, use at a dilution of 1:1,000 to 1:5,000.
How should the rabbit anti-ESE-1 polyclonal antibody 2645 be stored to maintain stability?
The antibody is stable for at least one year when stored at -20°C. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of the anti-ESE-1 antibody 2645?
The antibody is a rabbit polyclonal antibody with an IgG isotype.
What immunogen sequences were used to generate the rabbit anti-ESE-1 polyclonal antibody 2645?
The immunogen consists of the N-terminal sequence MAATCEISNIFSNYFS and the C-terminal sequence SSGWKEEEVLQSRN of the human ESE-1 protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.