| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Eotaxin |
| available sizes | 100 µg |
rabbit anti-Eotaxin (CT) polyclonal antibody 8682
$445.00
Antibody summary
- Rabbit polyclonal to Eotaxin (CT)
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-Eotaxin (CT) polyclonal antibody 8682
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. Positive control: Native and recombi- nant protein. |
| Immunogen Peptide corresponding to aa 83-97 of human eotaxin. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CCL11 Eotaxin |
| Protein names Eotaxin |
| Alternative names C-C motif chemokine 11, Eosinophil chemotactic protein, Small-inducible cytokine A11 |
| Gene names CCL11 |
| Protein family Belongs to the intercrine beta (chemokine CC) family |
| Function Chemokine that plays a central role in both allergic and non-allergic inflammatory reactions by inducing the migration of different leukocyte types including eosinophils, basophils, macrophages and dendritic cells (PubMed:8597956, PubMed:33846499). Exerts its effects primarily by binding to the CCR3 receptor (PubMed:8631813). Induces also chemotaxis of endothelial cells and promotes angiogenesis by activating the PI3K/Akt pathway (PubMed:28279120) |
| Subcellular location Secreted |
| Post-translational modification O-linked glycan consists of a Gal-GalNAc disaccharide which is modified with up to 2 sialic acid residues |
| Keywords 3D-structure, Chemotaxis, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Inflammatory response, Reference proteome, Secreted, Signal |
| Sequence MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP |
| UniProt accession: P51671 |
Data
 |
| Western blot analysis of eotaxin in HeLa cell lysate containing 10, 2.5, or 1 ng of full length recombinant eotaxin with eotaxin antibody at 1 µg/mL. |
 |
| Immunocytochemistry of Eotaxin in 293 cells with Eotaxin antibody at 5 µg/mL. |
 |
| Immunofluorescence of Eotaxin in 293 cells with Eotaxin antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Eotaxin (CT) polyclonal antibody suitable for?
This antibody is validated for use in ELISA, Western blot (WB), immunocytochemistry (ICC), and immunofluorescence (IF) applications.
How should the rabbit anti-Eotaxin (CT) antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this rabbit anti-Eotaxin (CT) polyclonal antibody?
The immunogen is a peptide corresponding to amino acids 83-97 of human eotaxin.
Which secondary antibodies are compatible with this rabbit anti-Eotaxin (CT) polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC, both in standard and cross-absorbed forms.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.