| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Elk-1 (Phospho-Ser383) |
| available sizes | 100 µL |
rabbit anti-Elk-1 (Phospho-Ser383) polyclonal antibody 4295
$366.00
Antibody summary
- Rabbit polyclonal to Elk-1 (Phospho-Ser383)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-Elk-1 (Phospho-Ser383) polyclonal antibody 4295
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Western blotting: use at dilution of 1:500- 1:1,000. A band of ~47kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 383 (T-L-S(p)-P-I) derived from human Elk-1 and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens ELK1 ETS domain-containing protein Elk-1 |
| Protein names ETS domain-containing protein Elk-1 |
| Gene names ELK1 |
| Protein family Belongs to the ETS family |
| Function Transcription factor that binds to purine-rich DNA sequences (PubMed:10799319, PubMed:7889942). Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2 (PubMed:1630903). Induces target gene transcription upon JNK and MAPK-signaling pathways stimulation (PubMed:7889942) |
| Subcellular location Nucleus |
| Structure Interacts in its sumoylated form with PIAS2/PIASX which enhances its transcriptional activator activity (PubMed:15920481). Interacts with MAD2L2; the interaction is direct and promotes phosphorylation by the kinases MAPK8 and/or MAPK9 (PubMed:17296730). Interacts with POU1F1 (PubMed:26612202) |
| Post-translational modification Sumoylation represses transcriptional activator activity as it results in recruitment of HDAC2 to target gene promoters which leads to decreased histone acetylation and reduced transactivator activity. It also regulates nuclear retention On mitogenic stimulation, phosphorylated on C-terminal serine and threonine residues by MAPK1. Ser-383 and Ser-389 are the preferred sites for MAPK1. In vitro, phosphorylation by MAPK1 potentiates ternary complex formation with the serum responses factors, SRE and SRF. Also phosphorylated on Ser-383 by MAPK8 and/or MAKP9. Phosphorylation leads to loss of sumoylation and restores transcriptional activator activity. Phosphorylated and activated by CAMK4, MAPK11, MAPK12 and MAPK14. Upon bFGF stimulus, phosphorylated by PAK1 (By similarity). Phosphorylated by PRP4K at Thr-417; phosphorylation activation ELK1 transcriptional activity (PubMed:10799319) |
| Keywords 3D-structure, Activator, Alternative splicing, Direct protein sequencing, DNA-binding, Glycoprotein, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation |
| Sequence MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV LSPGPQKP |
| UniProt accession: P19419 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended working dilutions for using the rabbit anti-Elk-1 (Phospho-Ser383) polyclonal antibody in Western blot and immunohistochemistry?
For Western blot applications, the recommended dilution range is 1:500 to 1:1,000, where a band of approximately 47 kDa is detected. For immunohistochemistry, the suggested dilution is between 1:50 and 1:100. Users should optimize dilutions based on their specific experimental conditions.
How should the rabbit anti-Elk-1 (Phospho-Ser383) polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C, where it remains stable for at least one year. It is supplied in a liquid form with a PBS buffer (without Mg2+ and Ca2+), pH 7.4, containing 150 mM NaCl.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.