| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | ECS |
| available sizes | 100 µg |
rabbit anti-ECS (DYKDDDDK) polyclonal antibody 8775
$426.00
Antibody summary
- Rabbit polyclonal to ECS
- Suitable for: WB,IP,ICC,ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-ECS (DYKDDDDK) polyclonal antibody 8775
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA,IP |
| Recommended dilutions Immunoblotting: use at a dilution of 1:1,000- 1:20,000 Immunocytochemistry: use at a dilution of 1:100-1:400. Immunoprecipitation: use 1-4ug/mg lysate ELISA: for detection use at a dilution of 1:1,000-1:30,000; for coating use at a dilution of 1:100-1:500. These are r |
| Immunogen DDDDK conjugated to KLH. |
| Size and concentration 100µg and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at 2-8°C. |
| Storage buffer Phosphate Buffered Saline (PBS), 0.09% NaN |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TMPRSS15 Enteropeptidase |
| Protein names Enteropeptidase |
| Alternative names Enterokinase, Serine protease 7, Transmembrane protease serine 15 |
| Gene names TMPRSS15 |
| Protein family Belongs to the peptidase S1 family |
| Function Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases |
| Catalytic activity Activation of trypsinogen by selective cleavage of 6-Lys-|-Ile-7 bond. |
| Subcellular location Membrane |
| Structure Heterodimer of a catalytic (light) chain and a multidomain (heavy) chain linked by a disulfide bond |
| Post-translational modification The chains are derived from a single precursor that is cleaved by a trypsin-like protease |
| Involvement in disease Enterokinase deficiency Life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. |
| Keywords 3D-structure, Disulfide bond, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Myristate, Protease, Proteomics identification, Reference proteome, Repeat, Serine protease, Signal-anchor, Transmembrane, Transmembrane helix, Zymogen |
| Sequence MGSKRGISSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGAALGQSHEARA TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII VVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNV SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA THYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETN PGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDL NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFN AFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSST NFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPG PVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVN LCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLG LGSGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD ITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEE NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNITENMICAGYE EGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH |
| UniProt accession: P98073 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended dilutions for using the rabbit anti-ECS (DYKDDDDK) polyclonal antibody in different applications?
For immunoblotting (WB), use at a dilution between 1:1,000 and 1:20,000. For immunocytochemistry (ICC/IF), a dilution of 1:100 to 1:400 is recommended. For immunoprecipitation (IP), use 1-4 µg of antibody per mg of lysate. For ELISA, detection is effective at 1:1,000 to 1:30,000 dilution, and coating should be done at 1:100 to 1:500 dilution.
How should the rabbit anti-ECS (DYKDDDDK) polyclonal antibody be stored to maintain stability?
This antibody should be stored at 2-8°C and is stable for at least one year under these conditions. It is supplied in a phosphate buffered saline (PBS) solution containing 0.09% sodium azide as a preservative.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.