| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DREAM |
| available sizes | 100 µg |
rabbit anti-DREAM polyclonal antibody 5090
$376.00
Antibody summary
- Rabbit polyclonal to DREAM
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-DREAM polyclonal antibody 5090
| target relevance |
|---|
| Homo sapiens KCNIP3 Calsenilin |
| Protein names Calsenilin |
| Alternative names A-type potassium channel modulatory protein 3, DRE-antagonist modulator, Kv channel-interacting protein 3 |
| Gene names KCNIP3 |
| Protein family Belongs to the recoverin family |
| Function Calcium-dependent transcriptional repressor that binds to the DRE element of genes including PDYN and FOS. Affinity for DNA is reduced upon binding to calcium and enhanced by binding to magnesium. Seems to be involved in nociception (By similarity) |
| Subcellular location Cytoplasm, Cell membrane, Endoplasmic reticulum, Golgi apparatus, Nucleus |
| Structure Binds to DNA as a homomultimer. Dimerization is induced by binding to calcium (PubMed:17962406). Interacts with the C-terminus of PSEN1 and PSEN2 and with PSEN2 CTF subunit. Associates with KCN1. Component of heteromultimeric potassium channels. Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Interacts with KCND2 and KCND3 |
| Post-translational modification Palmitoylated. Palmitoylation enhances association with the plasma membrane (By similarity) Proteolytically cleaved by caspase-3 Phosphorylation at Ser-63 inhibits cleavage by CASP3 |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Calcium, Cell membrane, Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Ion channel, Ion transport, Isopeptide bond, Lipoprotein, Membrane, Metal-binding, Nucleus, Palmitate, Phosphoprotein, Potassium, Potassium channel, Potassium transport, Proteomics identification, Reference proteome, Repeat, Repressor, Transcription, Transcription regulation, Transport, Ubl conjugation, Voltage-gated channel |
| Sequence MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDG YITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ KDENIMSSMQLFENVI |
| UniProt accession: Q9Y2W7 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-DREAM polyclonal antibody 5090 validated for, and what are the recommended dilutions?
The rabbit anti-DREAM polyclonal antibody 5090 is validated for Western blot (WB) applications. The recommended dilution for immunoblotting is 1:500 to 1:1,000.
How should the rabbit anti-DREAM polyclonal antibody 5090 be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to maintain antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.