| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DRAK2 (CT) |
| available sizes | 100 µg |
rabbit anti-DRAK2 (CT) polyclonal antibody 6903
$445.00
Antibody summary
- Rabbit polyclonal to DRAK2 (CT)
- Suitable for: ELISA,WB,ICC
- Isotype: IgG
- 100 µg
rabbit anti-DRAK2 (CT) polyclonal antibody 6903
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunocytochemistry: use at 10ug/mL. Positive control: Whole cell lysate from Jurkat or Raji cells. These are recommended concentrations. Enduser should determine optimal concentrations or their applications. |
| Immunogen Peptide corresponding to aa 351-365 of human DRAK2 (accession no. AB011421). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens STK17B Serine/threonine-protein kinase 17B |
| Protein names Serine/threonine-protein kinase 17B |
| Alternative names DAP kinase-related apoptosis-inducing protein kinase 2 |
| Gene names STK17B |
| Protein family Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily |
| Function Phosphorylates myosin light chains (By similarity). Acts as a positive regulator of apoptosis |
| Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Subcellular location Nucleus, Cell membrane, Endoplasmic reticulum-Golgi intermediate compartment |
| Structure Interacts with CHP1; the interaction induces CHP1 to translocate from the Golgi to the nucleus |
| Post-translational modification Autophosphorylated |
| Keywords 3D-structure, Apoptosis, ATP-binding, Cell membrane, Kinase, Membrane, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase |
| Sequence MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYA AKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFS LCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDF GMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDN QETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFEN LFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSL PNPHELVSDLLC |
| UniProt accession: O94768 |
Data
 |
| Western blot analysis of DRAK2 in Raji cell lysate with DRAK2 antibody at (A) 1 and B (2) µg/mL. |
 |
| Immunocytochemistry of DRAK2 in Jurkat cells with DRAK2 antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-DRAK2 (CT) polyclonal antibody 6903 been validated for?
This antibody has been tested and validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA assays.
How should I store the rabbit anti-DRAK2 (CT) polyclonal antibody to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. Avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution for using this antibody in immunoblotting and immunocytochemistry?
For immunoblotting, a concentration of 1 µg/mL is recommended, whereas for immunocytochemistry, a concentration of 10 µg/mL is advised. Optimal concentrations should be determined by the end user for their specific applications.
What is the immunogen used to generate the rabbit anti-DRAK2 (CT) polyclonal antibody 6903?
The immunogen is a peptide corresponding to amino acids 351-365 of the human DRAK2 protein (accession no. AB011421).
Which species does the rabbit anti-DRAK2 (CT) polyclonal antibody 6903 specifically recognize?
This antibody specifically reacts with the C-terminal region of the human DRAK2 protein (STK17B).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.