| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DRAK1 (NT) |
| available sizes | 100 µg |
rabbit anti-DRAK1 (NT) polyclonal antibody 2814
$445.00
Antibody summary
- Rabbit polyclonal to DRAK1 (NT)
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-DRAK1 (NT) polyclonal antibody 2814
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting : use at 1ug/mL. Immunocytochemistry: use at 2ug/mL. Positive control: Whole cell lysate from A431 or MOLT4 cells. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 5-19 of human DRAK1 (accession no. Q9UEE5). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens STK17A Serine/threonine-protein kinase 17A |
| Protein names Serine/threonine-protein kinase 17A |
| Alternative names DAP kinase-related apoptosis-inducing protein kinase 1 |
| Gene names STK17A |
| Protein family Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily |
| Function Acts as a positive regulator of apoptosis. Also acts as a regulator of cellular reactive oxygen species |
| Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Subcellular location Nucleus |
| Post-translational modification Autophosphorylated |
| Keywords 3D-structure, Apoptosis, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase |
| Sequence MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYS LCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPW VINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTR DVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPI SMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRT LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSE TKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY |
| UniProt accession: Q9UEE5 |
Data
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-DRAK1 (NT) polyclonal antibody 2814 validated for?
This antibody is suitable and tested for ELISA, Western blot (WB), immunocytochemistry (ICC), and immunofluorescence (IF) applications.
How should the rabbit anti-DRAK1 (NT) antibody be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-DRAK1 (NT) polyclonal antibody 2814?
The immunogen is a peptide corresponding to amino acids 5-19 of the human DRAK1 protein (accession no. Q9UEE5).
What are the recommended antibody dilutions for Western blot and immunocytochemistry using this antibody?
For Western blot, the recommended dilution is 1 µg/mL, and for immunocytochemistry, it is 2 µg/mL. Users should optimize concentrations for their specific experiments.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.













Reviews
There are no reviews yet.