| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DNase II (CT) |
| available sizes | 100 µg |
rabbit anti-Dnase II (CT) polyclonal antibody 7746
$445.00
Antibody summary
- Rabbit polyclonal to Dnase II (CT)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-Dnase II (CT) polyclonal antibody 7746
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunohistochemistry: use at 5ugml. Positive control: Tissue lysate of human spleen. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 347- 360 of human DNase II precursor (accession no. AF047016). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens DNASE2 Deoxyribonuclease-2-alpha |
| Protein names Deoxyribonuclease-2-alpha |
| Alternative names Acid DNase, Deoxyribonuclease II alpha, Lysosomal DNase II, R31240_2 |
| Gene names DNASE2 |
| Protein family Belongs to the DNase II family |
| Function Hydrolyzes DNA under acidic conditions with a preference for double-stranded DNA. Plays a major role in the clearance of nucleic acids generated through apoptosis, hence preventing autoinflammation (PubMed:29259162, PubMed:31775019). Necessary for proper fetal development and for definitive erythropoiesis in fetal liver and bone marrow, where it degrades nuclear DNA expelled from erythroid precursor cells (PubMed:29259162) |
| Catalytic activity Endonucleolytic cleavage to nucleoside 3'-phosphates and 3'-phosphooligonucleotide end-products. |
| Subcellular location Lysosome |
| Post-translational modification Glycosylated. Genetic variations that affect N-glycosylation sites reduce activity, but enzymatic deglycosylation has no effect |
| Involvement in disease Autoinflammatory-pancytopenia syndrome An autosomal recessive disorder characterized by severe anemia and thrombocytopenia apparent from early infancy, hepatosplenomegaly, and recurrent fevers associated with a hyperinflammatory state. Additional systemic features may include chronic diarrhea, proteinuria with renal disease, liver fibrosis with elevated liver enzymes, deforming arthropathy, and vasculitic skin lesions. Some patients may have motor delay or learning difficulties associated with subcortical white matter lesions on brain imaging. |
| Keywords Alternative splicing, Apoptosis, Developmental protein, Disease variant, Disulfide bond, Endonuclease, Glycoprotein, Hydrolase, Lysosome, Nuclease, Proteomics identification, Reference proteome, Signal |
| Sequence MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGG WRDGRALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLL DHDGGFWLVHSVPNFPPPASSAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPW VYNYQLEGIFAQEFPDLENVVKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYS GWLAAALGTNLQVQFWHKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRAYKI |
| UniProt accession: O00115 |
Data
 |
| Western blot analysis of DNase II in human spleen tissue lysate in the absence (lane 1) or presence (lane 2) of blocking peptide with DNase antibody II at 1:500 dilution. |
 |
| Immunohistochemistry of DNaseII in human spleen tissue with DNaseII antibody at 5 µg/mL. |
 |
| Immunofluorescence of DNase II in human spleen tissue with DNase II antibody at 5 µg/mL.
Green: DNase II antibody (7746) Red: Phylloidin staining Blue: DAPI staining |
 |
| Immunohistochemistry of DNase II in human spleen tissue with DNase II antibody at 5 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Dnase II (CT) polyclonal antibody 7746 been validated for?
This antibody has been tested and is suitable for Western blot (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.
How should the rabbit anti-Dnase II (CT) polyclonal antibody 7746 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-Dnase II (CT) polyclonal antibody 7746?
The immunogen is a peptide corresponding to amino acids 347 to 360 of the human DNase II precursor (accession no. AF047016).
Which secondary antibodies are compatible for detection with the rabbit anti-Dnase II (CT) polyclonal antibody 7746?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific, conjugated with peroxidase, biotin, or FITC, including cross-absorbed versions for enhanced specificity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.