| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DFF40/CAD (I18) |
| available sizes | 100 µg |
rabbit anti-DFF40/CAD (I18) polyclonal antibody 2093
$445.00
Antibody summary
- Rabbit polyclonal to DFF40/CAD (I18)
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-DFF40/CAD (I18) polyclonal antibody 2093
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL Immunocytochemistry: use at 5ug/mL. Positive control: Whole cell lysate of K562 or Jurkat cells. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 147-164 near the center of murine CAD (accession no. NP_031885). The sequence differs from human DFF40 by two amino acids. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus DFFB DNA fragmentation factor subunit beta |
| Protein names DNA fragmentation factor subunit beta |
| Alternative names Caspase-activated deoxyribonuclease, DNA fragmentation factor 40 kDa subunit |
| Gene names Dffb |
| Function Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology |
| Subcellular location Cytoplasm, Nucleus |
| Structure Heterodimer of DFFA and DFFB (By similarity). Interacts with H1-1 (By similarity) |
| Keywords 3D-structure, Apoptosis, Cytoplasm, Hydrolase, Nuclease, Nucleus, Reference proteome |
| Sequence MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTD DCFPGLPNDAELLLLTAGETWHGYVSDITRFLSVFNEPHAGVIQAARQLLSDEQAPLRQK LLADLLHHVSQNITAETREQDPSWFEGLESRFRNKSGYLRYSCESRIRGYLREVSAYTSM VDEAAQEEYLRVLGSMCQKLKSVQYNGSYFDRGAEASSRLCTPEGWFSCQGPFDLESCLS KHSINPYGNRESRILFSTWNLDHIIEKKRTVVPTLAEAIQDGREVNWEYFYSLLFTAENL KLVHIACHKKTTHKLECDRSRIYRPQTGSRRKQPARKKRPARKR |
| UniProt accession: O54788 |
Data
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-DFF40/CAD (I18) polyclonal antibody 2093 target?
This antibody targets DFF40/CAD, specifically recognizing the protein in murine species, with the immunogen peptide corresponding to amino acids 147-164 near the center of murine CAD. It differs from the human DFF40 sequence by two amino acids.
Which applications is the rabbit anti-DFF40/CAD (I18) antibody suitable for?
The antibody has been validated for use in ELISA, Western blotting (WB), immunocytochemistry (ICC), and immunofluorescence (IF) applications.
What are the recommended working dilutions for this antibody in Western blot and immunocytochemistry?
For Western blotting, a concentration of 1 µg/mL is recommended, while for immunocytochemistry, a concentration of 5 µg/mL is advised. However, end users should optimize concentrations for their specific experimental conditions.
How should the rabbit anti-DFF40/CAD (I18) antibody be stored to maintain stability?
The antibody is stable for at least one year when stored at -20°C. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the clonality and isotype of this DFF40/CAD antibody?
This product is a rabbit polyclonal antibody with an IgG isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.















Reviews
There are no reviews yet.