| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DFF (NT) |
| available sizes | 100 µg |
rabbit anti-DFF (NT) polyclonal antibody 8483
$445.00
Antibody summary
- Rabbit polyclonal to DFF (NT)
- Suitable for: ELISA,WB
- Isotype: IgG
- 100 µg
rabbit anti-DFF (NT) polyclonal antibody 8483
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 2ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Whole cell lysate from HeLa cells. |
| Immunogen Peptide corresponding to aa 2-21 at the N-terminus of human DFF45 (accession no. NP_004392). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens DFFA DNA fragmentation factor subunit alpha |
| Protein names DNA fragmentation factor subunit alpha |
| Alternative names DNA fragmentation factor 45 kDa subunit, Inhibitor of CAD |
| Gene names DFFA |
| Function Inhibitor of the caspase-activated DNase (DFF40) |
| Subcellular location Cytoplasm |
| Structure Heterodimer of DFFA and DFFB |
| Post-translational modification Caspase-3 cleaves DFF45 at 2 sites to generate an active factor |
| Keywords 3D-structure, Acetylation, Alternative splicing, Apoptosis, Cytoplasm, Direct protein sequencing, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT QSLHSLRSISASKASPPGDLQNPKRARQDPT |
| UniProt accession: O00273 |
Data
![]() |
| Western blot analysis of DFF45 in HeLa cell lysate with DFF45 antibody at (A) 1 and (B) 2 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications and usage concentrations for the rabbit anti-DFF (NT) polyclonal antibody 8483?
This antibody is suitable for Western blotting (WB) and ELISA applications. For immunoblotting, a recommended dilution is 2 µg/mL, but end users should optimize concentrations for their specific experiments.
How should the rabbit anti-DFF (NT) polyclonal antibody 8483 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-DFF (NT) polyclonal antibody 8483?
The immunogen is a peptide corresponding to amino acids 2-21 at the N-terminus of human DFF45, based on the accession number NP_004392.
Which secondary antibodies are compatible with the rabbit anti-DFF (NT) polyclonal antibody 8483?
Compatible secondary antibodies include various goat anti-rabbit IgG antibodies specific to heavy and light chains, conjugated to peroxidase, biotin, or FITC, some of which are cross-absorbed for reduced background.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.









Reviews
There are no reviews yet.