| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DFF (CT) |
| available sizes | 100 µg |
rabbit anti-DFF (CT) BP polyclonal antibody 6651
$445.00
Antibody summary
- Rabbit polyclonal to DFF (CT) BP
- Suitable for: ELISA,WB,IHC-P,IP,IF
- Isotype: IgG
- 100 µg
rabbit anti-DFF (CT) BP polyclonal antibody 6651
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA,IP |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunocytochemistry: use at 5ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Whole cell lysate from HeLa cells. |
| Immunogen Peptide corresponding to aa 313-331 at the C-terminus of human DFF45 (accession no. NP_004392). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens DFFA DNA fragmentation factor subunit alpha |
| Protein names DNA fragmentation factor subunit alpha |
| Alternative names DNA fragmentation factor 45 kDa subunit, Inhibitor of CAD |
| Gene names DFFA |
| Function Inhibitor of the caspase-activated DNase (DFF40) |
| Subcellular location Cytoplasm |
| Structure Heterodimer of DFFA and DFFB |
| Post-translational modification Caspase-3 cleaves DFF45 at 2 sites to generate an active factor |
| Keywords 3D-structure, Acetylation, Alternative splicing, Apoptosis, Cytoplasm, Direct protein sequencing, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVT LVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGA GLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLD QREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT QSLHSLRSISASKASPPGDLQNPKRARQDPT |
| UniProt accession: O00273 |
Data
 |
| Western blot analysis of DFF45 in HeLa (H), Jurkat (J), A431 (A), and K562 (K) whole cell lysate with DFF45 antibody at 1:1000 dilution. |
 |
| Immunocytochemistry of DFF45 in HeLa cells with DFF45 antibody at 5 µg/mL. |
 |
| Immunofluorescence of DFF45 in Hela cells with DFF45 antibody at 20 µg/mL.
Green: DFF45 Antibody (1409) Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-DFF (CT) BP polyclonal antibody 6651 been tested for?
This antibody has been validated for use in Western blotting (WB), immunohistochemistry (IHC), enzyme-linked immunosorbent assay (ELISA), immunoprecipitation (IP), and immunofluorescence (IF).
How should I store the rabbit anti-DFF (CT) BP polyclonal antibody to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-DFF (CT) BP polyclonal antibody 6651?
The immunogen is a peptide corresponding to amino acids 313-331 at the C-terminus of human DFF45 (accession no. NP_004392).
What is the recommended concentration for using this antibody in immunocytochemistry and Western blotting?
For immunoblotting (Western blot), a concentration of 1 µg/mL is recommended, while for immunocytochemistry, 5 µg/mL is suggested. Optimal concentrations should be determined by the end user for their specific applications.
Which host species and isotype is the anti-DFF (CT) BP antibody derived from?
This antibody is a rabbit polyclonal antibody of the IgG isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.