| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DENTT |
| available sizes | 100 µg |
rabbit anti-DENTT polyclonal antibody 2092
$376.00
Antibody summary
- Rabbit polyclonal to DENTT
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-DENTT polyclonal antibody 2092
| target relevance |
|---|
| Homo sapiens TSPYL2 Testis-specific Y-encoded-like protein 2 |
| Protein names Testis-specific Y-encoded-like protein 2 |
| Alternative names Cell division autoantigen 1, Cutaneous T-cell lymphoma-associated antigen se20-4, Differentially-expressed nucleolar TGF-beta1 target protein, Nuclear protein of 79 kDa |
| Gene names TSPYL2 |
| Protein family Belongs to the nucleosome assembly protein (NAP) family |
| Function Part of the CASK/TBR1/TSPYL2 transcriptional complex which modulates gene expression in response to neuronal synaptic activity, probably by facilitating nucleosome assembly. May inhibit cell proliferation by inducing p53-dependent CDKN1A expression |
| Subcellular location Nucleus, Cytoplasm |
| Structure Interacts with histones. Interacts with CASK. Part of a complex containing CASK, TBR1 and TSPYL2 (By similarity) |
| Post-translational modification Phosphorylation at Ser-20 and/or Thr-340 impairs function on cell proliferation |
| Keywords Cell cycle, Chromatin regulator, Cytoplasm, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation |
| Sequence MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLAD MRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPT PEASGGSLEIDFQVVQSSSFGGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDER ESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRL KRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDA SHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSE NPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYG NNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSED VWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG |
| UniProt accession: Q9H2G4 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for Western blot applications using the rabbit anti-DENTT polyclonal antibody?
For Western blot (WB) applications, it is recommended to use the rabbit anti-DENTT polyclonal antibody at a dilution between 1:500 and 1:1,000.
How should the rabbit anti-DENTT polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What type of immunogen was used to generate the rabbit anti-DENTT polyclonal antibody?
The immunogen used to produce this antibody was the human DENTT protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.