Skip to content

rabbit anti-DEDAF polyclonal antibody 3011

$445.00

Antibody summary

  • Rabbit polyclonal to DEDAF
  • Suitable for: ELISA,WB,IHC-P,IF
  • Isotype: IgG
  • 100 µg
SKU: 3011parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

DEDAF

available sizes

100 µg

rabbit anti-DEDAF polyclonal antibody 3011

antibody
Tested applications
WB,IHC,IHC,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: use at 1ug/mL.

Immunohistochemistry: use at 10ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.

Positive control: Whole cell lysate from A549 or HepG2 cells.
Immunogen
Peptide corresponding to aa 215-229 of human DEDAF (accession no. AF179286). This sequence is identical to that of mouse.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens RYBP
RING1 and YY1-binding protein
Protein names
RING1 and YY1-binding protein
Alternative names
Apoptin-associating protein 1, Death effector domain-associated factor, YY1 and E4TF1-associated factor 1
Gene names
RYBP
Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:25519132). Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites (By similarity). Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes (PubMed:19098711). May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis (PubMed:14765135, PubMed:27060496). May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1 (PubMed:11953439). May bind to DNA (By similarity). May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3 (PubMed:27748911)
Subcellular location
Nucleus, Cytoplasm, Nucleus, nucleoplasm
Structure
Monomer. Component of repressive BCOR complex containing Polycomb group subcomplex at least composed of BCOR, PCGF1, RING1 and RNF2/RING2 (PubMed:16943429). Component of PCR1-like complexes (PubMed:20696397, PubMed:26687479). Interacts with PCGF1 (PubMed:26687479). Part of a PCR1-like complex that contains AUTS2, PCGF5, RNF2, CSNK2B and RYBP (PubMed:25519132). Interacts with RNF2; the interaction is direct (PubMed:20696397). Interacts with CBX2, YAF2, RING1 and RNF2 (By similarity). Interacts with ubiquitin and ubiquitinated proteins (By similarity). Interacts with ubiquitinated histone H2A (By similarity). Interacts with apoptin, DEDD, FADD, CASP8, CASP10, YY1 and GABPB1 (PubMed:11395500, PubMed:11953439, PubMed:14765135). Together with GABPB1 and YY1, it forms a ternary complex, probably being the bridge factor between these two transcription factors (PubMed:11953439). Interacts with MDM2, and thereby inhibits ubiquitination of TP53 (PubMed:19098711). Identified in a ternary complex containing MDM2, TP53 and RYBP (PubMed:19098711). Interacts with FANK1; may prevent the ubiquitin-mediated proteasomal degradation of FANK1 (PubMed:27060496). Interacts with IFT57 (By similarity)
Post-translational modification
Monoubiquitinated
Keywords
3D-structure, Apoptosis, Cytoplasm, DNA-binding, Isopeptide bond, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger
Sequence
MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQ LVAQQVAQQYATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKD PPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSS STSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
UniProt accession: Q8N488

Data

benchmark-antibodies_anti-dedaf_antibody_3011_1.jpg
Western blot analysis of DEDAF expression in human A549 (lane A), HepG2 (lane B), and mouse 3T3 (lane C) cell lysates with DEDAF antibody at 1 µg/mL.
benchmark-antibodies_anti-dedaf_antibody_3011_2.gif
Immunohistochemistry of DEDAF in mouse liver tissue with DEDAF antibody at 5 µg/mL.
benchmark-antibodies_anti-dedaf_antibody_3011_3.jpg
Immunofluorescence of DEDAF in A549 cells with DEDAF antibody at 20 µg/mL.
benchmark-antibodies_anti-dedaf_antibody_3011_4.jpg
Immunohistochemistry of DEDAF in mouse liver tissue with DEDAF antibody at 10 µg/mL.
benchmark-antibodies_anti-dedaf_antibody_3011_5.gif
Immunofluorescence of DEDAF in mouse liver tissue with DEDAF antibody at 20 µg/mL.

FAQ & Publications

Frequently Asked Questions
What is the recommended dilution for using the rabbit anti-DEDAF polyclonal antibody in immunoblotting applications?
For immunoblotting (Western blot), it is recommended to use the rabbit anti-DEDAF polyclonal antibody at a concentration of 1 µg/mL. However, end users should optimize this concentration for their specific experiments.
How should the rabbit anti-DEDAF polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Which species does the immunogen peptide used to generate this antibody correspond to, and how does this affect cross-reactivity?
The immunogen is a peptide corresponding to amino acids 215-229 of human DEDAF (accession no. AF179286). This peptide sequence is identical to that of mouse DEDAF, suggesting the antibody is reactive with both human and mouse DEDAF proteins.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.