| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DcR3 (NT) |
| available sizes | 100 µg |
rabbit anti-DcR3 (NT) polyclonal antibody 4137
$445.00
Antibody summary
- Rabbit polyclonal to DcR3 (NT)
- Suitable for: ELISA,WB,IHC-P
- Isotype: IgG
- 100 µg
rabbit anti-DcR3 (NT) polyclonal antibody 4137
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Human heart tissue lysate. |
| Immunogen Peptide corresponding to aa 31-46 of human DcR3 precursor (accession no. AF104419). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNFRSF6B Tumor necrosis factor receptor superfamily member 6B |
| Protein names Tumor necrosis factor receptor superfamily member 6B |
| Alternative names Decoy receptor 3, Decoy receptor for Fas ligand, M68 |
| Gene names TNFRSF6B |
| Function Decoy receptor that can neutralize the cytotoxic ligands TNFS14/LIGHT, TNFSF15 and TNFSF6/FASL. Protects against apoptosis |
| Subcellular location Secreted |
| Keywords 3D-structure, Apoptosis, Direct protein sequencing, Disulfide bond, Glycoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Secreted, Signal |
| Sequence MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQR PCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFF AHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLA LNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPE GWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH |
| UniProt accession: O95407 |
Data
 |
| Western blot analysis of DcR3 in human heart (H), brain (B), and kidney (K) tissue lysates with DcR3 antibody at 1:500 dilution. |
 |
| Immunohistochemistry of DcR3 in human heart tissue with DcR3 antibody at 1 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-DcR3 (NT) polyclonal antibody 4137 suitable for?
This antibody is suitable for ELISA, Western blot (WB), and immunohistochemistry on paraffin-embedded tissue sections (IHC-P). It is also validated for ICC/IF applications.
How should the rabbit anti-DcR3 (NT) polyclonal antibody 4137 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-DcR3 (NT) polyclonal antibody 4137?
The immunogen is a peptide corresponding to amino acids 31-46 of the human DcR3 precursor protein (accession number AF104419).
Which species does the rabbit anti-DcR3 (NT) polyclonal antibody 4137 react with?
The antibody specifically reacts with the human DcR3 (NT) protein, as demonstrated by detection in human tissue lysates such as heart, brain, and kidney.
What is the recommended dilution for immunoblotting using this antibody?
For Western blot applications, the recommended concentration is 1 µg/mL. However, end users should optimize the antibody concentration based on their specific experimental conditions.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.