| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DcR2 |
| available sizes | 100 µg |
rabbit anti-DcR2 polyclonal antibody 6363
$445.00
Antibody summary
- Rabbit polyclonal to DcR2
- Suitable for: ELISA,WB,ICC,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-DcR2 polyclonal antibody 6363
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunocytochemistry: use at 10ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Whole cell lysate from HeLa cells. |
| Immunogen Peptide corresponding to aa 249-263 of human DcR2 precursor (accession no. Q9UBN6). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNFRSF10D Tumor necrosis factor receptor superfamily member 10D |
| Protein names Tumor necrosis factor receptor superfamily member 10D |
| Alternative names Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain |
| Gene names TNFRSF10D |
| Function Receptor for the cytotoxic ligand TRAIL (PubMed:9430226). Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis (PubMed:9537512). Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway (PubMed:9382840, PubMed:9430226) |
| Subcellular location Membrane |
| Keywords Apoptosis, Direct protein sequencing, Disulfide bond, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix |
| Sequence MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL AELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE TIQDQLVGSEKLFYEEDEAGSATSCL |
| UniProt accession: Q9UBN6 |
Data
 |
| Western blot analysis of DcR2 in HeLa whole cell lysate with DcR2 antibody at 1 µg/mL. |
 |
| Immunocytochemistry staining of HeLa cells using DcR2 antibody at 10ug/mL. |
 |
| Immunohistochemistry of DcR2 in mouse kidney node tissue with DcR2 antibody at 2.5 µg/mL. |
 |
| Immunofluorescence of DcR2 in mouse kidney tissue withDcR2 antibody at 20 µg/mL.
Green: DcR2 Antibody (6363) Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-DcR2 polyclonal antibody 6363 validated for?
This antibody is suitable for ELISA, Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry on paraffin-embedded tissues (IHC-P). Recommended dilutions are 1 µg/mL for immunoblotting and 10 µg/mL for immunocytochemistry.
How should the rabbit anti-DcR2 polyclonal antibody 6363 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-DcR2 polyclonal antibody 6363?
The antibody was raised against a peptide corresponding to amino acids 249-263 of the human DcR2 precursor protein, based on UniProt accession number Q9UBN6.
Which species or protein target does the rabbit anti-DcR2 polyclonal antibody 6363 recognize?
This antibody specifically targets the human DcR2 protein, also known as Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), which is expressed in various human tissues including fetal kidney, lung, liver, and adult testis and liver.
Is the rabbit anti-DcR2 polyclonal antibody 6363 compatible with secondary antibodies, and if so, which types?
Yes, it is compatible with several goat anti-rabbit IgG secondary antibodies including peroxidase-conjugated, biotin-conjugated, FITC-conjugated, and cross-absorbed polyclonal antibodies targeting the heavy and light chains.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.