| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DcR1 (ED2) |
| available sizes | 100 µg |
rabbit anti-DcR1 (ED2) polyclonal antibody 5097
$445.00
Antibody summary
- Rabbit polyclonal to DcR1 (ED2)
- Suitable for: ELISA,WB,IF
- Isotype: IgG
- 100 µg
rabbit anti-DcR1 (ED2) polyclonal antibody 5097
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunofluorescence: use at 10ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Whole cell lysate from HeLa cells. |
| Immunogen Peptide corresponding to aa 111- 123 at the extracellular domain (ED) of human DcR1 precursor (accession no. AAB67104). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNFRSF10C Tumor necrosis factor receptor superfamily member 10C |
| Protein names Tumor necrosis factor receptor superfamily member 10C |
| Alternative names Antagonist decoy receptor for TRAIL/Apo-2L, Decoy TRAIL receptor without death domain, Decoy receptor 1, Lymphocyte inhibitor of TRAIL, TNF-related apoptosis-inducing ligand receptor 3, TRAIL receptor without an intracellular domain |
| Gene names TNFRSF10C |
| Function Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand |
| Subcellular location Cell membrane |
| Post-translational modification N-glycosylated and O-glycosylated |
| Keywords Apoptosis, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Repeat, Signal |
| Sequence MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY LSCTIVGIIVLIVLLIVFV |
| UniProt accession: O14798 |
Data
 |
| Western blot analysis of DcR1 in HeLa cell (A), mouse (B) and rat (C) liver tissue lysates with DcR1 antibody at 1 µg/mL. |
 |
| Immunofluorescence of DcR1 in rat liver tissue with DcR1 antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-DcR1 (ED2) polyclonal antibody 5097 been validated for?
This antibody has been tested and validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA.
What are the recommended working concentrations for this antibody in immunoblotting and immunofluorescence?
The recommended dilution for immunoblotting is 1 µg/mL, while for immunofluorescence it is 10 µg/mL. However, end users should optimize concentrations for their specific experimental conditions.
How should the rabbit anti-DcR1 (ED2) antibody 5097 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-DcR1 (ED2) polyclonal antibody 5097?
The immunogen is a peptide corresponding to amino acids 111 to 123 within the extracellular domain of the human DcR1 precursor protein (accession no. AAB67104).
Which host species and isotype does the anti-DcR1 (ED2) antibody 5097 belong to, and what is its clonality?
This antibody is a rabbit polyclonal antibody of the IgG isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.