| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DAP Kinase 2 |
| available sizes | 100 µg |
rabbit anti-DAPK2 polyclonal antibody 5513
$445.00
Antibody summary
- Rabbit polyclonal to DAPK2
- Suitable for: ELISA,WB,IHC-P
- Isotype: IgG
- 100 µg
rabbit anti-DAPK2 polyclonal antibody 5513
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunohistochemistry: use at 2ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Whole cell lysate from A431cells. |
| Immunogen Peptide corresponding to aa 356-370 of human DAPK2 (accession no. BAA88063). This sequence is identical to that of mouse. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens DAPK2 Death-associated protein kinase 2 |
| Protein names Death-associated protein kinase 2 |
| Alternative names DAP-kinase-related protein 1 |
| Gene names DAPK2 |
| Protein family Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily |
| Function Calcium/calmodulin-dependent serine/threonine kinase involved in multiple cellular signaling pathways that trigger cell survival, apoptosis, and autophagy. Regulates both type I apoptotic and type II autophagic cell death signals, depending on the cellular setting. The former is caspase-dependent, while the latter is caspase-independent and is characterized by the accumulation of autophagic vesicles. Acts as a mediator of anoikis and a suppressor of beta-catenin-dependent anchorage-independent growth of malignant epithelial cells. May play a role in granulocytic maturation (PubMed:17347302). Regulates granulocytic motility by controlling cell spreading and polarization (PubMed:24163421) |
| Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Subcellular location Cytoplasm, Cytoplasmic vesicle, autophagosome lumen |
| Structure Homodimer in its autoinhibited state. Active as monomer (By similarity). Isoform 2 but not isoform 1 can interact with ATF4. Interacts with 14-3-3 proteins YWHAB, YWHAE, YWHAG, YWHAH, YWHAQ, YWHAZ and SFN; the interaction requires DAPK2 phosphorylation at Thr-369 and suppresses DAPK2 kinase activity and DAPK2-induced apoptosis (PubMed:26047703) |
| Post-translational modification Autophosphorylation at Ser-318 inhibits its catalytic activity. Dephosphorylated at Ser-318 in response to activated Fas and TNF receptors |
| Keywords 3D-structure, Alternative splicing, Apoptosis, ATP-binding, Calmodulin-binding, Cytoplasm, Cytoplasmic vesicle, Kinase, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase |
| Sequence MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR ASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKES LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDNQQAMVRRESV VNLENFRKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRPDEDLRNCESDTEEDIARRKA LHPRRRSSTS |
| UniProt accession: Q9UIK4 |
Data
 |
| Western blot analysis of DAPK2 in A431 (H), mouse spleen (M), and rat kidney (R) lysates with DAPK2 antibody at 1 µg/mL. |
 |
| Immunohistochemistry of DAPK2 in mouse spleen cells with DAPK2 antibody at 2 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-DAPK2 polyclonal antibody 5513 been validated for, and what are the recommended dilutions?
This antibody has been tested and is suitable for Western blotting (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA. Recommended dilutions are 1 µg/mL for immunoblotting and 2 µg/mL for immunohistochemistry. Users should optimize concentrations for their specific assays.
How should the rabbit anti-DAPK2 polyclonal antibody 5513 be stored to maintain stability?
The antibody is supplied in a liquid form at 1 mg/mL in PBS buffer, pH 7.4. It should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.