| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | WB |
| reactivity | Cytochrome P450 |
| available sizes | 200 µg, 50 µg |
rabbit anti-cytochrome p450 polyclonal antibody 4747
Price range: $264.00 through $434.00
Antibody summary
- Rabbit polyclonal to cytochrome p450
- Suitable for: WB
- Isotype: IgG
- 50 µg, 200 µg
rabbit anti-cytochrome p450 polyclonal antibody 4747
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: Use at 1-5ug/mL. A band of ~50-55kDa is detected. These are recommended concentrations. Endusers should determine optimal concentrations for their application. |
| Immunogen Native rat cytochrome P450. |
| Size and concentration 50, 200, 1000µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS, pH 7.2, 50% glycerol, 0.09% NaN3 |
| Purity protein affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CYP2A7 Cytochrome P450 2A7 |
| Protein names Cytochrome P450 2A7 |
| Alternative names CYPIIA7, Cytochrome P450 IIA4 |
| Gene names CYP2A7 |
| Protein family Belongs to the cytochrome P450 family |
| Function Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics |
| Catalytic activity an organic molecule + reduced [NADPH--hemoprotein reductase] + O2 = an alcohol + oxidized [NADPH--hemoprotein reductase] + H2O + H(+) |
| Subcellular location Endoplasmic reticulum membrane, Microsome membrane |
| Keywords Endoplasmic reticulum, Heme, Iron, Membrane, Metal-binding, Microsome, Monooxygenase, Oxidoreductase, Proteomics identification, Reference proteome |
| Sequence MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMK FSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSN GERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSN VISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKL LQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI AGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQ RFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDK GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVF ATIPRNYTMSFLPR |
| UniProt accession: P20853 |
Data
 |
| Detection of cytochrome P450 in human liver microsomes (Lane 2), rat liver microsomes (Lane 3), mouse liver microsomes (Lane 4), rabbit liver microsomes (Lane 5). |
|
| Detection of cytochrome P450 in human liver microsomes (Lane 2), rat liver microsomes (Lane 3), mouse liver microsomes (Lane 4), rabbit liver microsomes (Lane 5). |
|
| Detection of cytochrome P450 in human liver microsomes (Lane 2), rat liver microsomes (Lane 3), mouse liver microsomes (Lane 4), rabbit liver microsomes (Lane 5). |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-cytochrome P450 polyclonal antibody in Western blot applications?
For Western blotting, the recommended dilution of the rabbit anti-cytochrome P450 polyclonal antibody is 1-5 µg/mL. Users should optimize the antibody concentration to suit their specific experimental conditions.
How should the rabbit anti-cytochrome P450 polyclonal antibody be stored to maintain stability?
The antibody is stable for at least one year when stored at -20°C. It is supplied in a storage buffer containing PBS at pH 7.2, 50% glycerol, and 0.09% sodium azide (NaN3).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.