| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Cyclin E2 |
| available sizes | 100 µg |
rabbit anti-Cyclin E2 polyclonal antibody 3718
$376.00
Antibody summary
- Rabbit polyclonal to Cyclin E2
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-Cyclin E2 polyclonal antibody 3718
| target relevance |
|---|
| Homo sapiens CCNE2 G1/S-specific cyclin-E2 |
| Protein names G1/S-specific cyclin-E2 |
| Gene names CCNE2 |
| Protein family Belongs to the cyclin family. Cyclin E subfamily |
| Function Essential for the control of the cell cycle at the late G1 and early S phase |
| Subcellular location Nucleus |
| Structure Interacts with the CDK2 (in vivo) and CDK3 (in vitro) protein kinases to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex |
| Post-translational modification Phosphorylation by CDK2 triggers its release from CDK2 and degradation via the ubiquitin proteasome pathway Lactylated at Lys-348 (PubMed:36896611). Delactylated by SIRT3 (PubMed:36896611) |
| Keywords 3D-structure, Alternative splicing, Cell cycle, Cell division, Cyclin, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH |
| UniProt accession: O96020 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Cyclin E2 polyclonal antibody 3718 been tested for, and what are the recommended dilutions?
This antibody has been tested for ELISA, Immunocytochemistry/Immunofluorescence (ICC/IF), and Western Blot (WB) applications. For immunoblotting, the recommended dilution range is 1:500 to 1:1,000.
How should the rabbit anti-Cyclin E2 polyclonal antibody 3718 be stored to maintain its stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.