| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Cyclin E1 |
| available sizes | 100 µg |
rabbit anti-Cyclin E1 polyclonal antibody 5435
$376.00
Antibody summary
- Rabbit polyclonal to Cyclin E1
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-Cyclin E1 polyclonal antibody 5435
| target relevance |
|---|
| Homo sapiens CCNE1 G1/S-specific cyclin-E1 |
| Protein names G1/S-specific cyclin-E1 |
| Gene names CCNE1 |
| Protein family Belongs to the cyclin family. Cyclin E subfamily |
| Function Essential for the control of the cell cycle at the G1/S (start) transition |
| Subcellular location Nucleus |
| Structure Interacts with CDK2 protein kinase to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex (PubMed:15660127). Found in a complex with CDK2, CABLES1 and CCNA1 (By similarity). Part of a complex consisting of UHRF2, CDK2 and CCNE1 (PubMed:15178429). Interacts directly with UHRF2; the interaction ubiquitinates CCNE1 and appears to occur independently of CCNE1 phosphorylation (PubMed:21952639). Interacts with INCA1 (PubMed:21540187) |
| Post-translational modification Phosphorylation of both Thr-395 by GSK3 and Ser-399 by CDK2 creates a high affinity degron recognized by FBXW7, and accelerates degradation via the ubiquitin proteasome pathway. Phosphorylation at Thr-77 creates a low affinity degron also recognized by FBXW7 Ubiquitinated by UHRF2; appears to occur independently of phosphorylation |
| Keywords 3D-structure, Alternative splicing, Cell cycle, Cell division, Cyclin, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation |
| Sequence MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA |
| UniProt accession: P24864 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for immunoblotting using the rabbit anti-Cyclin E1 polyclonal antibody 5435?
For immunoblotting (Western blot), it is recommended to use the antibody at a dilution of 1:500 to 1:1,000.
Which species does the rabbit anti-Cyclin E1 polyclonal antibody 5435 specifically react with?
This antibody specifically reacts with the Cyclin E1 protein.
How should the rabbit anti-Cyclin E1 polyclonal antibody 5435 be stored to ensure stability?
The antibody should be stored at -70°C and is stable for at least one year. Avoid multiple freeze-thaw cycles to maintain its stability.
What is the immunogen used to produce the rabbit anti-Cyclin E1 polyclonal antibody 5435?
The immunogen is a peptide corresponding to amino acids 43-52 of the Cyclin E1 protein.
Is this antibody suitable for ELISA applications?
Yes, the rabbit anti-Cyclin E1 polyclonal antibody 5435 is suitable for use in ELISA assays.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.