| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CX3CR1 (EL) |
| available sizes | 100 µg |
rabbit anti-CX3CR1 (EL) polyclonal antibody 8563
$445.00
Antibody summary
- Rabbit polyclonal to CX3CR1 (EL)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-CX3CR1 (EL) polyclonal antibody 8563
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500 dilution. Positive control: Whole cell lysate of THP-1 cells. |
| Immunogen Peptide corresponding to aa 175- 189 of human CX3CR1. The sequence is identical to that of rat CX3CR1 and differs from that of mouse CX3CR1 by one amino acid. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CX3CR1 CX3C chemokine receptor 1 |
| Protein names CX3C chemokine receptor 1 |
| Alternative names Beta chemokine receptor-like 1, Fractalkine receptor, G-protein coupled receptor 13, V28 |
| Gene names CX3CR1 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function Receptor for the C-X3-C chemokine fractalkine (CX3CL1) present on many early leukocyte cells; CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed:12055230, PubMed:23125415, PubMed:9390561, PubMed:9782118). CX3CR1-CX3CL1 signaling mediates cell migratory functions (By similarity). Responsible for the recruitment of natural killer (NK) cells to inflamed tissues (By similarity). Acts as a regulator of inflammation process leading to atherogenesis by mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques, promoting cell survival (By similarity). Involved in airway inflammation by promoting interleukin 2-producing T helper (Th2) cell survival in inflamed lung (By similarity). Involved in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells (By similarity). Acts as a negative regulator of angiogenesis, probably by promoting macrophage chemotaxis (PubMed:14581400, PubMed:18971423). Plays a key role in brain microglia by regulating inflammatory response in the central nervous system (CNS) and regulating synapse maturation (By similarity). Required to restrain the microglial inflammatory response in the CNS and the resulting parenchymal damage in response to pathological stimuli (By similarity). Involved in brain development by participating in synaptic pruning, a natural process during which brain microglia eliminates extra synapses during postnatal development (By similarity). Synaptic pruning by microglia is required to promote the maturation of circuit connectivity during brain development (By similarity). Acts as an important regulator of the gut microbiota by controlling immunity to intestinal bacteria and fungi (By similarity). Expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of taking up bacteria in order to provide defense against pathogenic bacteria (By similarity). Required to initiate innate and adaptive immune responses against dissemination of commensal fungi (mycobiota) component of the gut: expressed in mononuclear phagocytes (MNPs) and acts by promoting induction of antifungal IgG antibodies response to confer protection against disseminated C.albicans or C.auris infection (PubMed:29326275). Also acts as a receptor for C-C motif chemokine CCL26, inducing cell chemotaxis (PubMed:20974991) |
| Subcellular location Cell membrane |
| Structure (Microbial infection) Interacts with HIV-1 envelope polyprotein gp160 |
| Post-translational modification This protein is not N-glycosylated which is unusual for G-protein-coupled receptors |
| Involvement in disease Macular degeneration, age-related, 12 A form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane. |
| Keywords 3D-structure, Adaptive immunity, Age-related macular degeneration, Alternative splicing, Cell membrane, Disulfide bond, G-protein coupled receptor, Host-virus interaction, Immunity, Inflammatory response, Innate immunity, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Transducer, Transmembrane, Transmembrane helix |
| Sequence MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |
| UniProt accession: P49238 |
Data
 |
| Western blot analysis of CX3CR1 in THP-1 cell lysate with CX3CR1 antibody at 1 µg/mL in (A) the absence and (B) the presence of blocking peptide. |
 |
| Immunohistochemistry of CX3CR1 in human spleen cells with CX3CR1 antibody at 10 µg/mL. |
 |
| Immunofluorescence of CX3CR1 in THP-1 cells with CX3CR1 antibody at 20 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-CX3CR1 (EL) polyclonal antibody 8563 react with?
This antibody was raised against a peptide corresponding to amino acids 175-189 of human CX3CR1, with the sequence identical to rat CX3CR1 and differing by one amino acid from mouse CX3CR1, indicating reactivity with human and rat CX3CR1 and likely cross-reactivity with mouse CX3CR1.
Which applications has the rabbit anti-CX3CR1 (EL) polyclonal antibody 8563 been validated for?
The antibody has been tested and is suitable for use in ELISA, Western blotting (WB), immunohistochemistry on paraffin-embedded tissues (IHC-P), and immunofluorescence (IF/ICC). Recommended dilution for immunoblotting is 1:500 using THP-1 whole cell lysate as a positive control.
What are the recommended storage conditions for maintaining the stability of this antibody?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to maintain antibody integrity.
What is the host species and clonality of this anti-CX3CR1 antibody?
The antibody is a rabbit polyclonal IgG, affinity purified using the specific peptide immunogen.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.