| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CKIIα' |
| available sizes | 100 µg |
rabbit anti-CKII α polyclonal antibody 2271
$518.00
Antibody summary
- Rabbit polyclonal to CKII α
- Suitable for: WB,IP
- Isotype: Whole IgG
- 100 µg
rabbit anti-CKII α polyclonal antibody 2271
| antibody |
|---|
| Tested applications WB,IP |
| Recommended dilutions Western Blot: 0.2 - 1 ug/ml. Immunoprecipitation: 4-10 ug/mg lysate. |
| Immunogen Synthetic peptide representing a portion of the protein located within exon 11 (LocusLink ID 1459). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions Store at 2 - 8°C. Antibody is stable at 2 - 8°C for 1 year. |
| Storage buffer Tris-citrate/phosphate buffer, pH 7 to 8 contai |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CSNK2A2 Casein kinase II subunit alpha' |
| Protein names Casein kinase II subunit alpha' |
| Gene names CSNK2A2 |
| Protein family Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily |
| Function Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine (PubMed:11239457, PubMed:11704824, PubMed:16193064, PubMed:30898438). Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection (PubMed:11704824, PubMed:16193064, PubMed:30898438). May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response (PubMed:12631575, PubMed:19387551, PubMed:19387552). During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage (PubMed:12631575, PubMed:19387551, PubMed:19387552). Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation (PubMed:11239457). Phosphorylates a number of DNA repair proteins in response to DNA damage, such as MDC1, RAD9A, RAD51 and HTATSF1, promoting their recruitment to DNA damage sites (PubMed:20545769, PubMed:21482717, PubMed:22325354, PubMed:26811421, PubMed:30898438, PubMed:35597237). Can also negatively regulate apoptosis (PubMed:19387551, PubMed:19387552). Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3 (PubMed:12631575, PubMed:19387551, PubMed:19387552). Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8 (PubMed:12631575, PubMed:19387551, PubMed:19387552). Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV (PubMed:12631575, PubMed:19387551, PubMed:19387552). Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB (PubMed:12631575, PubMed:19387551, PubMed:19387552). Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function (PubMed:19387550). Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1 (PubMed:19387549). Acts as an ectokinase that phosphorylates several extracellular proteins (PubMed:12631575, PubMed:19387551, PubMed:19387552). During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV (PubMed:12631575, PubMed:19387551, PubMed:19387552). May phosphorylate histone H2A on 'Ser-1' (PubMed:38334665) |
| Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Subcellular location Nucleus, Cytoplasm |
| Structure Heterotetramer composed of two catalytic subunits (alpha chain and/or alpha' chain) and two regulatory subunits (beta chains). The tetramer can exist as a combination of 2 alpha/2 beta, 2 alpha'/2 beta or 1 alpha/1 alpha'/2 beta subunits. Also part of a CK2-SPT16-SSRP1 complex composed of SSRP1, SUPT16H, CSNK2A1, CSNK2A2 and CSNK2B, which forms following UV irradiation (PubMed:11239457, PubMed:12393879). Interacts with CSNK2A2IP (via C-terminus) (By similarity). Interacts with SIRT6; preventing CSNK2A2 localization to the nucleus (By similarity). Interacts with RNPS1. Interacts with HIRIP3 (PubMed:38334665) |
| Keywords 3D-structure, Acetylation, Apoptosis, ATP-binding, Cell cycle, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transcription, Transcription regulation, Transferase, Wnt signaling pathway |
| Sequence MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
| UniProt accession: P19784 |
Data
 |
| Detection of human CKII alpha by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CKII alpha antibody 2271 (lot 2271-5) used for IP at 6 µg per reaction. CKII alpha was also immunoprecipitated by rabbit anti-CKII alpha antibody 13030. For blotting immunoprecipitated CKII alpha, 2271 was used at 1 µg /ml. Detection: Chemiluminescence with an exposure time of 10 seconds. |
 |
| Detection of human and mouse CKII alpha by western blot. Samples: Whole cell lysate (50 µg ) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CKII alpha antibody 2271 (lot 2271-5) used for WB at 0.1 µg /ml. Detection: Chemiluminescence with an exposure time of 30 seconds. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-CKII α polyclonal antibody 2271 been validated for?
This antibody is validated for use in Western Blot (WB) and Immunoprecipitation (IP) applications.
How should the rabbit anti-CKII α polyclonal antibody 2271 be stored to maintain stability?
The antibody should be stored at 2 to 8°C and is stable under these conditions for up to one year.
What is the recommended dilution for using this antibody in Western blot experiments?
For Western blot applications, the recommended dilution range is 0.2 to 1 µg/mL.
What is the host species and clonality of the anti-CKII α antibody 2271?
The antibody is a rabbit polyclonal IgG.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.