| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CIDE-A (CT) |
| available sizes | 100 µg |
rabbit anti-CIDE-A (CT) polyclonal antibody 5987
$445.00
Antibody summary
- Rabbit polyclonal to CIDE-A (CT)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-CIDE-A (CT) polyclonal antibody 5987
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 2ug/mL. Immunohistochemistry:use at 5ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Tissue lysate of mouse heart. |
| Immunogen Peptide corresponding to aa 200-214 of mouse CIDE-A (accession no. AAC34985). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus CIDEA Lipid transferase CIDEA |
| Protein names Lipid transferase CIDEA |
| Alternative names Cell death activator CIDE-A, Cell death-inducing DFFA-like effector A |
| Gene names Cidea |
| Protein family Belongs to the CIDE family |
| Function Lipid transferase that promotes unilocular lipid droplet formation by mediating lipid droplet fusion (PubMed:18509062, PubMed:22144693, PubMed:26609809, PubMed:36477540). Lipid droplet fusion promotes their enlargement, restricting lipolysis and favoring lipid storage (PubMed:18509062, PubMed:22144693, PubMed:26609809). Localizes on the lipid droplet surface, at focal contact sites between lipid droplets, and mediates atypical lipid droplet fusion by promoting directional net neutral lipid transfer from the smaller to larger lipid droplets (PubMed:18509062, PubMed:22144693, PubMed:26609809). The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair and occurs at a lower rate than that promoted by CIDEC (PubMed:18509062, PubMed:22144693). May also act as a CEBPB coactivator in epithelial cells to control the expression of a subset of CEBPB downstream target genes, including ID2, IGF1, PRLR, SOCS1, SOCS3, XDH, but not casein (PubMed:22245780). By interacting with CEBPB, strengthens the association of CEBPB with the XDH promoter, increases histone acetylation and dissociates HDAC1 from the promoter (PubMed:22245780). When overexpressed, induces apoptosis; the physiological significance of its role in apoptosis is unclear (PubMed:9564035) |
| Catalytic activity a triacyl-sn-glycerol(in) = a triacyl-sn-glycerol(out) |
| Subcellular location Lipid droplet, Nucleus |
| Structure Homodimer (PubMed:26609809). Interacts with CIDEC (By similarity). Directly interacts with CEBPB (PubMed:22245780). Interacts with isoform CLSTN3beta of CLSTN3; inhibiting the lipid transferase activity of CIDEA (PubMed:36477540) |
| Keywords Activator, Apoptosis, Lipid droplet, Nucleus, Reference proteome, Transcription, Transcription regulation |
| Sequence METARDYAGALIRPLTFMGLQTKKVLLTPLIHPARPFRVSNHDRSSRRGVMASSLQELIS KTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHFMILEKGQKWTPGSKYVPVCKQ PKKSGIARVTFDLYRLNPKDFLGCLNVKATMYEMYSVSYDIRCTSFKAVLRNLLRFMSYA AQMTGQFLVYAGTYMLRVLGDTEEQPSPKPSTKGWFM |
| UniProt accession: O70302 |
Data
 |
| Western blot analysis of CIDE-A in mouse heart tissue lysate with CIDE-A antibody at 1:500 dilution. |
 |
| Immunohistochemistry of CIDE-A in mouse heart tissue with CIDE-A antibody at 5 µg/mL. |
 |
| Immunofluorescence of CIDE-A in Mouse Heart cells with CIDE-A antibody at 20 µg/mL. |
 |
| Immunohistochemistry of CIDE-A in human brain tissue with CIDE-A antibody at 2.5 µg/mL. |
 |
| Immunofluorescence of CIDE-A in human brain tissue with CIDE A antibody at 20 µg/mL.
Green: CIDE-A Antibody (5987) Blue: DAPI staining |
 |
| Immunohistochemistry of CIDE-A in human brain tissue with CIDE A antibody at 2.5 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications for the rabbit anti-CIDE-A (CT) polyclonal antibody 5987?
This antibody is suitable for ELISA, Western blotting (WB), immunohistochemistry (IHC-P), and immunofluorescence (IF) applications.
How should the rabbit anti-CIDE-A (CT) antibody 5987 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-CIDE-A (CT) polyclonal antibody 5987?
The immunogen is a peptide corresponding to amino acids 200-214 of mouse CIDE-A (accession no. AAC34985).
Which secondary antibodies are compatible with the rabbit anti-CIDE-A (CT) polyclonal antibody 5987?
Compatible secondary antibodies include goat anti-rabbit IgG (H&L chain specific) conjugated with peroxidase, biotin, or FITC, including versions that are cross-adsorbed for reduced background.
What is the recommended dilution for using the rabbit anti-CIDE-A (CT) antibody 5987 in immunohistochemistry?
For immunohistochemistry, it is recommended to use the antibody at a concentration of 5 µg/mL; however, users should optimize this concentration for their specific experimental conditions.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.