| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CDC25a |
| available sizes | 100 µg |
rabbit anti-CDC25a polyclonal antibody 8227
$518.00
Antibody summary
- Rabbit polyclonal to CDC25a
- Suitable for: WB,IP
- Isotype: Whole IgG
- 100 µg
rabbit anti-CDC25a polyclonal antibody 8227
| antibody |
|---|
| Tested applications WB,IP |
| Recommended dilutions Western Blot: 0.1 - 1 ug/ml. Immunoprecipitation: 1- 4 ug/mg of lysate. |
| Immunogen Synthetic peptide representing a portion of the protein encoded by exon 7 (LocusLink ID 993). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions Store at 2 - 8°C. Antibody is stable at 2 - 8°C for 1 year. |
| Storage buffer Tris-citrate/phosphate buffer, pH 7 to 8 contai |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CDC25A M-phase inducer phosphatase 1 |
| Protein names M-phase inducer phosphatase 1 |
| Alternative names Dual specificity phosphatase Cdc25A |
| Gene names CDC25A |
| Protein family Belongs to the MPI phosphatase family |
| Function Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression (PubMed:12676925, PubMed:14559997, PubMed:1836978, PubMed:20360007). Directly dephosphorylates CDK1 and stimulates its kinase activity (PubMed:20360007). Also dephosphorylates CDK2 in complex with cyclin-E, in vitro (PubMed:20360007) |
| Catalytic activity O-phospho-L-tyrosyl-[protein] + H2O = L-tyrosyl-[protein] + phosphate |
| Structure Interacts with CCNB1/cyclin B1. Interacts with YWHAE/14-3-3 epsilon when phosphorylated. Interacts with CUL1 specifically when CUL1 is neddylated and active. Interacts with BTRC/BTRCP1 and FBXW11/BTRCP2. Interactions with CUL1, BTRC and FBXW11 are enhanced upon DNA damage. Interacts with CHEK2; mediates CDC25A phosphorylation and degradation in response to infrared-induced DNA damages. Interacts with HSP90AB1; prevents heat shock-mediated CDC25A degradation and contributes to cell cycle progression (PubMed:22843495) |
| Post-translational modification Phosphorylated by CHEK1 on Ser-76, Ser-124, Ser-178, Ser-279, Ser-293 and Thr-507 during checkpoint mediated cell cycle arrest. Also phosphorylated by CHEK2 on Ser-124, Ser-279, and Ser-293 during checkpoint mediated cell cycle arrest. Phosphorylation on Ser-178 and Thr-507 creates binding sites for YWHAE/14-3-3 epsilon which inhibits CDC25A. Phosphorylation on Ser-76, Ser-124, Ser-178, Ser-279 and Ser-293 may also promote ubiquitin-dependent proteolysis of CDC25A by the SCF complex. Phosphorylation of CDC25A at Ser-76 by CHEK1 primes it for subsequent phosphorylation at Ser-79, Ser-82 and Ser-88 by NEK11. Phosphorylation by NEK11 is required for BTRC-mediated polyubiquitination and degradation. Phosphorylation by PIM1 leads to an increase in phosphatase activity. Phosphorylated by PLK3 following DNA damage, leading to promote its ubiquitination and degradation Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C) ubiquitin ligase complex that contains FZR1/CDH1 during G1 phase leading to its degradation by the proteasome. Ubiquitinated by a SCF complex containing BTRC and FBXW11 during S phase leading to its degradation by the proteasome. Deubiquitination by USP17L2/DUB3 leads to its stabilization |
| Keywords 3D-structure, Alternative splicing, Cell cycle, Cell division, Hydrolase, Mitosis, Phosphoprotein, Protein phosphatase, Proteomics identification, Reference proteome, Ubl conjugation |
| Sequence MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL |
| UniProt accession: P30304 |
Data
 |
| Detection of human CDC25a by western blot of immunoprecipitates. Samples: Nuclear Extract (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells. Antibodies: Affinity purified rabbit anti-CDC25a antibody 8227 (lot 8227-2) used for IP at 6 µg per reaction. CDC25a was also immunoprecipitated by rabbit anti-CDC25a antibody. For blotting immunoprecipitated CDC25a, 8227 was used at 1 µg /ml. Detection: Chemiluminescence with an exposure time of 3 minutes. |
 |
| Detection of human CDC25a by western blot. Samples: Nuclear extract (50 µg ) from HeLa and HEK293T cells. Antibody: Affinity purified rabbit anti-CDC25a antibody 8227 (lot 8227-2) used for WB at 1 µg /ml. Detection: Chemiluminescence with an exposure time of 3 minutes. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-CDC25a polyclonal antibody 8227 been validated for?
The rabbit anti-CDC25a polyclonal antibody 8227 has been tested and is suitable for Western Blot (WB) and Immunoprecipitation (IP) applications. It is also compatible with immunocytochemistry/immunofluorescence (ICC/IF). Recommended dilutions are 0.1-1 µg/mL for Western Blot and 1-4 µg/mg of lysate for Immunoprecipitation.
How should the rabbit anti-CDC25a antibody 8227 be stored to maintain stability?
The antibody should be stored as a liquid at 2-8°C. It is stable under these conditions for up to one year. The storage buffer consists of a Tris-citrate/phosphate buffer with a pH between 7 and 8.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.