| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CCR8 |
| available sizes | 100 µg |
rabbit anti-CCR8 (EL) polyclonal antibody 5309
$445.00
Antibody summary
- Rabbit polyclonal to CCR8 (EL)
- Suitable for: ELISA,WB
- Isotype: IgG
- 100 µg
rabbit anti-CCR8 (EL) polyclonal antibody 5309
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. Positive control: Tissue lysate from human spleen. |
| Immunogen Peptide corresponding to aa 183-201 of human CCR8 which is located in the second extracellular loop. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CCR8 C-C chemokine receptor type 8 |
| Protein names C-C chemokine receptor type 8 |
| Alternative names CC chemokine receptor CHEMR1, CMKBRL2, Chemokine receptor-like 1, GPR-CY6, TER1 |
| Gene names CCR8 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function G protein-coupled receptor that can bind a variety of chemokines, such as CCL1, CCL8, CCL16, CCL18 (PubMed:23999500, PubMed:35041514). Regulates monocyte and eosinophil chemotaxis. Undergoes internalization upon CCL18 binding, leading to induced migration and calcium flux of highly polarized Th2 cells (PubMed:23999500). In microglial cells, promotes phagocytosis with CCL18 through NF-kappa-B and Src signaling pathways (PubMed:35041514). Stimulation of the CCL1-CCR8 signaling axis protects the gut from acute intestinal damage (By similarity) |
| Subcellular location Cell membrane |
| Structure (Microbial infection) Interacts with Kaposi virus proteins vCCL1 and vCCL2 |
| Keywords 3D-structure, Alternative splicing, Cell membrane, Disulfide bond, G-protein coupled receptor, Membrane, Proteomics identification, Receptor, Reference proteome, Transducer, Transmembrane, Transmembrane helix |
| Sequence MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL |
| UniProt accession: P51685 |
Data
 |
| Western blot analysis of CCR8 in human spleen lysate with CCR8 antibody at 1:500 dilution. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-CCR8 (EL) polyclonal antibody 5309 validated for?
This antibody is validated for use in Western blot (WB) and ELISA applications.
How should the rabbit anti-CCR8 (EL) antibody 5309 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. Avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-CCR8 (EL) polyclonal antibody 5309?
The immunogen is a peptide corresponding to amino acids 183-201 of human CCR8, located in the second extracellular loop of the protein.
What is the recommended dilution range for immunoblotting using this CCR8 antibody?
For Western blot analysis, it is recommended to use the antibody at a dilution of 1:500 to 1:1,000.
Which species does the rabbit anti-CCR8 (EL) polyclonal antibody 5309 specifically react with?
This antibody specifically reacts with human CCR8, as demonstrated using human spleen tissue lysate as a positive control.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.