| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CCR5 (NT) |
| available sizes | 100 µg |
rabbit anti-CCR5 (NT) polyclonal antibody 8869
$445.00
Antibody summary
- Rabbit polyclonal to CCR5 (NT)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-CCR5 (NT) polyclonal antibody 8869
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:1,000-1:2,000 dilution. Positive control: Whole cell lysate from THP-1 cells. |
| Immunogen Peptide corresponding to aa 6-20 of human CCR5. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CCR5 C-C chemokine receptor type 5 |
| Protein names C-C chemokine receptor type 5 |
| Alternative names CHEMR13, HIV-1 fusion coreceptor |
| Gene names CCR5 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor (PubMed:30713770) |
| Subcellular location Cell membrane |
| Structure (Microbial infection) Interacts with Kaposi virus protein vCCL2 |
| Post-translational modification Sulfated on at least 2 of the N-terminal tyrosines. Sulfation contributes to the efficiency of HIV-1 entry and is required for efficient binding of the chemokines, CCL3 and CCL4 O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site even if Ser-7 may be also O-glycosylated. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen Palmitoylation in the C-terminal is important for cell surface expression, and to a lesser extent, for HIV entry Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES |
| Involvement in disease Type 1 diabetes mellitus 22 A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical features are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. |
| Keywords 3D-structure, Cell membrane, Diabetes mellitus, Disulfide bond, G-protein coupled receptor, Glycoprotein, Host cell receptor for virus entry, Host-virus interaction, Lipoprotein, Membrane, Palmitate, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Sulfation, Transducer, Transmembrane, Transmembrane helix |
| Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
| UniProt accession: P51681 |
Data
 |
| Western blot analysis of CCR5 in THP-1 whole cell lysate with CCR5 antibody at 1 µg/mL. |
 |
| Immunohistochemistry of CCR5 in human lymph node tissue with CCR5 antibody at 20 µg/mL. |
 |
| Immunohistochemistry of CCR5 in human lymph node tissue with CCR5 antibody at 2.5 µg/mL. |
 |
| Immunofluorescence of CCR5 in human lymph node tissue with CCR5 antibody at 20 µg/mL.
Green: CCR5 Antibody (8869) Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-CCR5 (NT) polyclonal antibody 8869 validated for?
This antibody is suitable for ELISA, Western blotting (WB), immunohistochemistry on paraffin-embedded tissues (IHC-P), and immunofluorescence (IF). Recommended dilutions for immunoblotting are 1:1,000 to 1:2,000, using whole cell lysate from THP-1 cells as a positive control.
How should the rabbit anti-CCR5 (NT) polyclonal antibody 8869 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity. The antibody is supplied in PBS buffer at pH 7.4.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.