| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Caspase-13 |
| available sizes | 100 µg |
rabbit anti-Caspase-13 polyclonal antibody 3345
$445.00
Antibody summary
- Rabbit polyclonal to Caspase-13
- Suitable for: ELISA,WB,IHC-P
- Isotype: IgG
- 100 µg
rabbit anti-Caspase-13 polyclonal antibody 3345
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunohistochemistry: use at 10ug/mL. These are recommended concentrations. Endusers should determine optimal concentrations for their applications. Positive control: Whole cell lysate from HL60 cells. |
| Immunogen Peptide corresponding to aa 91- 105 of human caspase-13 (accession no. O75601). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Bos taurus CASP13 Caspase-13 |
| Protein names Caspase-13 |
| Alternative names Evolutionary related interleukin-1-beta-converting enzyme |
| Gene names CASP13 |
| Protein family Belongs to the peptidase C14A family |
| Function Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival |
| Structure Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a small and a large subunit |
| Post-translational modification The two subunits are derived from the precursor sequence by an autocatalytic mechanism or by cleavage by Caspase-8 |
| Keywords Alternative splicing, Apoptosis, Hydrolase, Protease, Reference proteome, Thiol protease, Zymogen |
| Sequence MAEDKHNKNPLKMLESLGKELISGLLDDFVEKNVLKLEEEEKKKIYDAKLQDKARVLVDS IRQKNQEAGQVFVQTFLNIDKNSTSIKAPEETVAGPDESVGSAATLKLCPHEEFLKLCKE RAGEIYPIKERKDRTRLALIICNTEFDHMPPRNGAALDILGMKQLLEGLGYTVEVEEKLT ARDMESVLWKFAAREEHKSSDSTFLVFMSHGILDGICGTMHSEEEPDVLPYDTIFRTFNN RNCLSLKDKPKVIIVQACRGANRGELWVSDSPPALADSFSQSSENLEEDAVYKTHVEKDF IAFCSSTPHNVSWRDIKKGSLFITRLITCFQKYAWCCHLEEVFRKVQQSFEKPNVKAQMP TVERLSMTRYFYLFPGN |
| UniProt accession: O75601 |
Data
 |
| Western blot analysis of caspase-13 in human HL60 cell lysate (A), mouse brain (B) and rat brain (C) tissue lysates with caspase-13 antibody at 1 µg/mL. |
 |
| Immunohistochemistry of caspase-13 in mouse brain tissue with caspase-13 antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution for using the rabbit anti-Caspase-13 polyclonal antibody in Western blot applications?
For immunoblotting (Western blot), the recommended concentration of the rabbit anti-Caspase-13 polyclonal antibody is 1 µg/mL. However, end users should optimize the concentration based on their specific experimental conditions.
How should the rabbit anti-Caspase-13 polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Which secondary antibodies are compatible with the rabbit anti-Caspase-13 polyclonal antibody for detection?
Compatible secondary antibodies include goat anti-rabbit IgG antibodies that are H&L chain specific and available with peroxidase conjugation, biotin conjugation, FITC conjugation, and cross-absorbed variants, such as catalog numbers 9512, 2079, 7863, 2371, 1715, and 1720.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.