| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Caspase-12 (NT) |
| available sizes | 100 µg |
rabbit anti-Caspase-12 (NT) polyclonal antibody 8362
$445.00
Antibody summary
- Rabbit polyclonal to Caspase-12 (NT)
- Suitable for: ELISA,WB,IHC-P
- Isotype: IgG
- 100 µg
rabbit anti-Caspase-12 (NT) polyclonal antibody 8362
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunohistochemistry: use at 10ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Tissue lysate of mouse brain. |
| Immunogen Peptide corresponding to aa 2-17 at the N-terminus of mouse caspase-12 (accession no. CAA73532). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus CASP12 Caspase-12 |
| Protein names Caspase-12 |
| Gene names Casp12 |
| Protein family Belongs to the peptidase C14A family |
| Function Involved in the activation cascade of caspases responsible for apoptosis execution |
| Structure Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by two subunits (Potential). Interacts with TRAF2 under resting conditions; this interaction is reduced in ER stress conditions |
| Keywords Apoptosis, Hydrolase, Phosphoprotein, Protease, Reference proteome, Thiol protease, Zymogen |
| Sequence MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVE NFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSSPSESKRKVEDDEMEVN AGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAKEIYPVMEKEGRTRLALI ICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQEMETELMQFAGRPEHQSS DSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNSNCRSLRNKPKILIMQACRG RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDFIAFKSSTPHNISWKVGKT GSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQMPTIERVSMTRYFYLFPGN |
| UniProt accession: O08736 |
Data
 |
| Western blot analysis of caspase-12 in (A) human and (B) mouse spleen tissue lysates with caspase-12 antibody at 1 µg/mL. |
 |
| Immunohistochemistry of caspase-12 in human heart tissue with caspase-12 antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Caspase-12 (NT) polyclonal antibody suitable for?
This antibody is suitable for use in ELISA, Western blot (WB), and Immunohistochemistry on paraffin-embedded sections (IHC-P). It has also been tested for ICC/IF applications.
How should the rabbit anti-Caspase-12 (NT) antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this rabbit polyclonal antibody targeting Caspase-12?
The antibody was raised against a peptide corresponding to amino acids 2-17 at the N-terminus of mouse caspase-12, based on the accession number CAA73532.
What is the recommended dilution for using this antibody in Western blot and immunohistochemistry?
For immunoblotting, the recommended concentration is 1 µg/mL. For immunohistochemistry, it is suggested to use the antibody at 10 µg/mL. Users should optimize concentrations for their specific applications.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.