| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Caspase-12 (IN) |
| available sizes | 100 µg |
rabbit anti-Caspase-12 (IN) polyclonal antibody 3322
$445.00
Antibody summary
- Rabbit polyclonal to Caspase-12 (IN)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-Caspase-12 (IN) polyclonal antibody 3322
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunohistochemistry: use at 2ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Tissue lysate of mouse brain. |
| Immunogen Peptide corresponding to aa 100-116 of mouse caspase-12 (accession no. CAA73532). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus CASP12 Caspase-12 |
| Protein names Caspase-12 |
| Gene names Casp12 |
| Protein family Belongs to the peptidase C14A family |
| Function Involved in the activation cascade of caspases responsible for apoptosis execution |
| Structure Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by two subunits (Potential). Interacts with TRAF2 under resting conditions; this interaction is reduced in ER stress conditions |
| Keywords Apoptosis, Hydrolase, Phosphoprotein, Protease, Reference proteome, Thiol protease, Zymogen |
| Sequence MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVE NFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSSPSESKRKVEDDEMEVN AGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAKEIYPVMEKEGRTRLALI ICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQEMETELMQFAGRPEHQSS DSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNSNCRSLRNKPKILIMQACRG RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDFIAFKSSTPHNISWKVGKT GSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQMPTIERVSMTRYFYLFPGN |
| UniProt accession: O08736 |
Data
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-Caspase-12 (IN) polyclonal antibody 3322 react with?
This antibody is reactive with Caspase-12 (IN), specifically derived from mouse caspase-12 peptide immunogen (aa 100-116). It can be used with mouse tissue lysates as a positive control.
Which experimental applications is this Caspase-12 antibody validated for?
The antibody has been tested and is suitable for Western blot (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.
What are the recommended antibody concentrations for use in immunoblotting and immunohistochemistry?
For immunoblotting, the recommended concentration is 1 µg/mL, and for immunohistochemistry, it is 2 µg/mL. Users should optimize concentrations based on their specific experimental conditions.
How should the rabbit anti-Caspase-12 (IN) polyclonal antibody 3322 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is advised to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species, clonality, and isotype of this Caspase-12 antibody?
This antibody is a rabbit polyclonal antibody with an IgG isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.













Reviews
There are no reviews yet.