| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | CAD (CT) |
| available sizes | 100 µg |
rabbit anti-CAD (117) polyclonal antibody 6485
$445.00
Antibody summary
- Rabbit polyclonal to CAD (117)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-CAD (117) polyclonal antibody 6485
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 2ug/mL. Immunohistochemistry: use at 2ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. Positive control: Mouse lung tissue lysate. |
| Immunogen Peptide corresponding to aa 205-222 of mouse CAD (accession no. O54788). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus DFFB DNA fragmentation factor subunit beta |
| Protein names DNA fragmentation factor subunit beta |
| Alternative names Caspase-activated deoxyribonuclease, DNA fragmentation factor 40 kDa subunit |
| Gene names Dffb |
| Function Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology |
| Subcellular location Cytoplasm, Nucleus |
| Structure Heterodimer of DFFA and DFFB (By similarity). Interacts with H1-1 (By similarity) |
| Keywords 3D-structure, Apoptosis, Cytoplasm, Hydrolase, Nuclease, Nucleus, Reference proteome |
| Sequence MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTD DCFPGLPNDAELLLLTAGETWHGYVSDITRFLSVFNEPHAGVIQAARQLLSDEQAPLRQK LLADLLHHVSQNITAETREQDPSWFEGLESRFRNKSGYLRYSCESRIRGYLREVSAYTSM VDEAAQEEYLRVLGSMCQKLKSVQYNGSYFDRGAEASSRLCTPEGWFSCQGPFDLESCLS KHSINPYGNRESRILFSTWNLDHIIEKKRTVVPTLAEAIQDGREVNWEYFYSLLFTAENL KLVHIACHKKTTHKLECDRSRIYRPQTGSRRKQPARKKRPARKR |
| UniProt accession: O54788 |
Data
 |
| Western blot analysis of CAD in mouse kidney tissue lysate with CAD antibody at 2 µg/mL. |
 |
| Immunohistochemistry of CAD in mouse kidney tissue with CAD antibody at 2 µg/mL. |
 |
| Immunofluorescence of CAD in Mouse Kidney cells with CAD antibody at 10 µg/mL. |
 |
| Immunohistochemistry of CAD in mouse kidney tissue with CAD antibody at 5 µg/mL. |
 |
| Immunofluorescence of CAD in mouse kidney tissue with CAD antibody at 5 µg/mL.
Green: CAD antibody (6485) Red: Phylloidin staining Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-CAD (117) polyclonal antibody 6485 been validated for?
This antibody has been tested and validated for use in Western blotting (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA.
How should the rabbit anti-CAD (117) polyclonal antibody 6485 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-CAD (117) polyclonal antibody 6485?
The immunogen is a peptide corresponding to amino acids 205-222 of mouse CAD, with UniProt accession number O54788.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.