Skip to content

rabbit anti-c-Jun (Phospho-Thr93) polyclonal antibody 6621

$366.00

Antibody summary

  • Rabbit polyclonal to c-Jun (Phospho-Thr93)
  • Suitable for: WB,IHC
  • Isotype: Whole IgG
  • 100 µl
SKU: 6621parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

c-Jun (Phospho-Thr93)

available sizes

100 µL

rabbit anti-c-Jun (Phospho-Thr93) polyclonal antibody 6621

antibody
Tested applications
WB,IHC,IHC
Recommended dilutions
Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~43kDa is detected.

Immunohistochemistry: use at dilution of 1:50- 1:100.

These are recommended working dilutions.

End user should determine optimal dilutions for their applications.
Immunogen
Peptide sequence that includes phosphorylation site of threonine 93 (T-T-T(p)-P-T) derived from human c-Jun and conjugated to KLH.
Size and concentration
100µL and 1 mg/mL
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C.
Storage buffer
PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl,
Purity
affinity purified
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens JUN
Transcription factor Jun
Protein names
Transcription factor Jun
Alternative names
Activator protein 1, Proto-oncogene c-Jun, Transcription factor AP-1 subunit Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39
Gene names
JUN
Protein family
Belongs to the bZIP family. Jun subfamily
Function
Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed:10995748, PubMed:22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to the AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing its transcriptional activity (By similarity). Together with FOSB, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway (PubMed:12618758). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed:17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306)
Subcellular location
Nucleus
Structure
Heterodimer with either BATF3 or ATF7 (PubMed:10376527, PubMed:12087103, PubMed:15467742). Heterodimer with FOS (By similarity). Heterodimer with FOSB isoform 1 and 2 (By similarity). Component of an AP-1 transcription factor complex composed of JUN-FOS heterodimers (By similarity). As part of the AP-1 transcription factor complex, forms heterodimers with FOSB, thereby binding to the AP-1 consensus sequence and stimulating transcription (By similarity). Interacts with FOS and FOSB isoform 1 and 2 (By similarity). The ATF7/JUN heterodimer is essential for ATF7 transactivation activity (PubMed:10376527). Interacts with TSC22D3 (via N-terminus); the interaction inhibits the binding of active AP1 to its target DNA (By similarity). Interacts with HIVEP3 and MYBBP1A (By similarity). Interacts with SP1, SPIB and TCF20 (PubMed:10196196, PubMed:16478997, PubMed:8663478). Interacts with COPS5; the interaction leads indirectly to its phosphorylation (PubMed:8837781). Component of the SMAD3/SMAD4/JUN/FOS/complex which forms at the AP1 promoter site (PubMed:10995748). The SMAD3/SMAD4 heterodimer acts synergistically with the JUN/FOS heterodimer to activate transcription in response to TGF-beta (PubMed:9732876). Interacts (via its basic DNA binding and leucine zipper domains) with SMAD3 (via an N-terminal domain); the interaction is required for TGF-beta-mediated transactivation of the SMAD3/SMAD4/JUN/FOS/complex (PubMed:10995748). Interacts with methylated RNF187 (PubMed:20852630, PubMed:23624934). Binds to HIPK3. Interacts (when phosphorylated) with FBXW7 (PubMed:14739463). Found in a complex with PRR7 and FBXW7 (PubMed:27458189). Interacts with PRR7 and FBXW7; the interaction inhibits ubiquitination-mediated JUN degradation promoting its phosphorylation and transcriptional activity (PubMed:27458189). Interacts with RBM39 (By similarity). Interacts with PAGE4 (PubMed:24263171, PubMed:24559171, PubMed:26242913). Interacts with ARK2N and CSNK2B; the interaction with ARK2N is mediated by CSNK2B (PubMed:31341047)
Post-translational modification
Ubiquitinated by the SCF(FBXW7), leading to its degradation (PubMed:14739463, PubMed:27458189). Ubiquitination takes place following phosphorylation, that promotes interaction with FBXW7 (PubMed:14739463)
Phosphorylated by CaMK4 and PRKDC; phosphorylation enhances the transcriptional activity. Phosphorylated by HIPK3. Phosphorylated by DYRK2 at Ser-243; this primes the protein for subsequent phosphorylation by GSK3B at Thr-239. Phosphorylated at Thr-239, Ser-243 and Ser-249 by GSK3B; phosphorylation reduces its ability to bind DNA. Phosphorylated by PAK2 at Thr-2, Thr-8, Thr-89, Thr-93 and Thr-286 thereby promoting JUN-mediated cell proliferation and transformation. Phosphorylated by PLK3 following hypoxia or UV irradiation, leading to increase DNA-binding activity. Phosphorylated by VRK1 (PubMed:31527692)
Acetylated at Lys-271 by EP300
Keywords
3D-structure, Acetylation, Activator, Direct protein sequencing, DNA-binding, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
UniProt accession: P05412

Data

No results found

FAQ & Publications

Frequently Asked Questions
What applications has the rabbit anti-c-Jun (Phospho-Thr93) polyclonal antibody 6621 been validated for?
This antibody has been tested and is suitable for use in Western blotting (WB) and immunohistochemistry (IHC). Recommended dilutions are 1:500-1:1,000 for immunoblotting and 1:50-1:100 for immunohistochemistry, with optimal dilutions to be determined by the end user.
How should the rabbit anti-c-Jun (Phospho-Thr93) polyclonal antibody 6621 be stored to maintain stability?
The antibody should be stored at -20°C where it remains stable for at least one year. It is supplied in a phosphate-buffered saline (PBS) solution without magnesium and calcium ions, at pH 7.4 with 150 mM NaCl.
What is the immunogen used for generating the rabbit anti-c-Jun (Phospho-Thr93) polyclonal antibody 6621?
The immunogen is a peptide sequence derived from human c-Jun that includes the phosphorylation site at threonine 93 (T-T-T(p)-P-T), conjugated to keyhole limpet hemocyanin (KLH).
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.