| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Bonzo (NT2) |
| available sizes | 100 µg |
rabbit anti-Bonzo (NT2) polyclonal antibody 9115
$445.00
Antibody summary
- Rabbit polyclonal to Bonzo (NT2)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-Bonzo (NT2) polyclonal antibody 9115
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500 dilution. Positive control: Tissue lysate of human spleen. |
| Immunogen Peptide corresponding to aa 11-25 at the N-terminus of human Bonzo. The sequence of this peptide differs from those of African green monkey and macaque by one or two amino acids, respectively. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CXCR6 C-X-C chemokine receptor type 6 |
| Protein names C-X-C chemokine receptor type 6 |
| Alternative names CDw186, G-protein coupled receptor STRL33, G-protein coupled receptor bonzo |
| Gene names CXCR6 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1 |
| Subcellular location Cell membrane |
| Keywords Cell membrane, Disulfide bond, G-protein coupled receptor, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Transducer, Transmembrane, Transmembrane helix |
| Sequence MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL |
| UniProt accession: O00574 |
Data
 |
| Western blot analysis of Bonzo in human spleen tissue lysate with Bonzo antibody at 1 µg/mL in (A) the absence or (B) the presence of blocking peptide. |
 |
| Immunohistochemistry of Bonzo in human spleen tissue with Bonzo antibody at 20 µg/mL. |
 |
| Immunohistochemistry of Bonzo in human spleen tissue with Bonzo antibody at 2.5 µg/mL. |
 |
| Immunofluorescence of Bonzo in human spleen tissue with Bonzo antibody at 20 µg/mL.
Green: Bonzo Antibody (9115) Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Bonzo (NT2) polyclonal antibody 9115 been validated for, and what are the recommended dilutions for Western blotting?
The rabbit anti-Bonzo (NT2) polyclonal antibody 9115 is suitable for ELISA, Western blot (WB), immunohistochemistry on paraffin-embedded sections (IHC-P), and immunofluorescence (IF). For Western blotting, the recommended dilution is 1:500, using a positive control such as human spleen tissue lysate.
How should the rabbit anti-Bonzo (NT2) polyclonal antibody 9115 be stored to maintain its stability, and what is its concentration and form?
This antibody is supplied as a liquid at a concentration of 1 mg/mL. It should be stored at -20°C to ensure stability for at least one year. To preserve antibody integrity, avoid multiple freeze-thaw cycles. The storage buffer is phosphate-buffered saline (PBS) at pH 7.4.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.