| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Bonzo (CT) |
| available sizes | 100 µg |
rabbit anti-Bonzo (CT) polyclonal antibody 3199
$469.00
Antibody summary
- Rabbit polyclonal to Bonzo (CT)
- Suitable for: ELISA,WB,IHC-P
- Isotype: IgG
- 100 µg
rabbit anti-Bonzo (CT) polyclonal antibody 3199
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions Immunoblotting: use at 1:1,000 dilution. Positive control: Whole cell lysate from SW1353 cells. |
| Immunogen Peptide corresponding to aa 319-338 at the C-terminus of human Bonzo. The sequence of this peptide is identical to those of macaque and African green monkey. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CXCR6 C-X-C chemokine receptor type 6 |
| Protein names C-X-C chemokine receptor type 6 |
| Alternative names CDw186, G-protein coupled receptor STRL33, G-protein coupled receptor bonzo |
| Gene names CXCR6 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1 |
| Subcellular location Cell membrane |
| Keywords Cell membrane, Disulfide bond, G-protein coupled receptor, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Transducer, Transmembrane, Transmembrane helix |
| Sequence MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL |
| UniProt accession: O00574 |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications and dilutions for the rabbit anti-Bonzo (CT) polyclonal antibody 3199?
This antibody is suitable for ELISA, Western blot (WB), and immunohistochemistry paraffin-embedded (IHC-P) applications. For immunoblotting, it is recommended to use at a 1:1,000 dilution with whole cell lysate from SW1353 cells as a positive control.
Can you describe the immunogen used to generate the rabbit anti-Bonzo (CT) polyclonal antibody 3199?
The immunogen is a peptide corresponding to amino acids 319-338 at the C-terminus of human Bonzo. This peptide sequence is identical to those of macaque and African green monkey.
How should the rabbit anti-Bonzo (CT) polyclonal antibody 3199 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of the anti-Bonzo (CT) antibody 3199, and what is its isotype?
The antibody is a rabbit polyclonal antibody with an IgG isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.









Reviews
There are no reviews yet.