| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Bmf (CT) |
| available sizes | 100 µg |
rabbit anti-Bmf (CT) polyclonal antibody 6805
$445.00
Antibody summary
- Rabbit polyclonal to Bmf (CT)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-Bmf (CT) polyclonal antibody 6805
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 2.5-5ug/mL. A band of 25kDa is detected. Immunofluorescence: use at 10ug/mL. These are recommended concentrations. Enduser should determine optimal concentration for their application. Positive control: HepG2 or 293 cell lysates. |
| Immunogen Peptide corresponding to aa 171- 184 of human Bmf (accession no. NP_277038). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens BMF Bcl-2-modifying factor |
| Protein names Bcl-2-modifying factor |
| Gene names BMF |
| Protein family Belongs to the Bcl-2 family |
| Function May play a role in apoptosis. Isoform 1 seems to be the main initiator |
| Structure Interacts with MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w. Interacts with the myosin V actin motor complex through its binding to DLC2 (By similarity) |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Proteomics identification, Reference proteome |
| Sequence MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG AGPR |
| UniProt accession: Q96LC9 |
Data
 |
| Western blot analysis of Bmf expression in HepG2 cell lysate with Bmf antibody at (A) 2.5 and (B) 5 µg/mL. |
 |
| Immunofluorescence of Bmf in human kidney tissue with Bmf antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Bmf (CT) polyclonal antibody 6805 been validated for?
This antibody has been tested and validated for use in Western blotting (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA.
How should the rabbit anti-Bmf (CT) polyclonal antibody 6805 be stored to maintain stability?
The antibody is stable for at least one year when stored at -20°C. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended concentration for using this antibody in immunoblotting and immunofluorescence?
For immunoblotting, use the antibody at 2.5–5 µg/mL, where a band of 25 kDa is detected. For immunofluorescence, a concentration of 10 µg/mL is suggested. Optimal concentrations may vary depending on the specific application.
What is the immunogen used to generate the rabbit anti-Bmf (CT) polyclonal antibody 6805?
The antibody was raised against a peptide corresponding to amino acids 171–184 of the human Bmf protein (accession number NP_277038).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.