| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | B-Cell Maturation protein (BCMA) |
| available sizes | 100 µg |
rabbit anti-BCMA polyclonal antibody 4802
$445.00
Antibody summary
- Rabbit polyclonal to BCMA
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-BCMA polyclonal antibody 4802
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Western Blot: Use at 2-5 ug/ml. A band of approximately 27 kD is detected using K562 cell lysate as a Positive control. |
| Immunogen A synthetic peptide corresponding to the carboxy terminus of human BCMA. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions Store at 4°C; stable for one year |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNFRSF17 Tumor necrosis factor receptor superfamily member 17 |
| Protein names Tumor necrosis factor receptor superfamily member 17 |
| Alternative names B-cell maturation protein |
| Gene names TNFRSF17 |
| Function Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK |
| Subcellular location Cell membrane, Endomembrane system |
| Structure Associates with TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6 |
| Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Chromosomal rearrangement, Disulfide bond, Immunity, Membrane, Proteomics identification, Proto-oncogene, Receptor, Reference proteome, Signal-anchor, Transmembrane, Transmembrane helix |
| Sequence MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR |
| UniProt accession: Q02223 |
Data
 |
| Western blot analysis of BCMA in (A) human spleen tissue lysate, (B) K562, and (C) U937 cell lysates with BCMA antibody at 5 µg/mL. |
 |
| Immunohistochemistry of BCMA in human spleen tissue with BCMA antibody at 5 µg/mL. |
 |
| Immunofluorescence of BCMA in Human Spleen tissue with BCMA antibody at 10 µg/mL. |
 |
| Immunohistochemistry of BCMA in human spleen tissue with BCMA antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-BCMA polyclonal antibody 4802 been tested and validated for?
This antibody has been tested and validated for use in Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry/Immunofluorescence (ICC/IF), and ELISA applications.
How should I store the rabbit anti-BCMA polyclonal antibody to maintain its stability?
Store the antibody at 4°C, where it remains stable for one year. It is supplied in a PBS buffer at pH 7.4.
What is the immunogen used to generate the rabbit anti-BCMA polyclonal antibody 4802?
The antibody was raised against a synthetic peptide corresponding to the carboxy terminus of human BCMA.
What is the recommended concentration and dilution for Western Blot using this BCMA antibody?
For Western Blot, use the antibody at a concentration of 2-5 µg/mL. A band of approximately 27 kD can be detected using K562 cell lysate as a positive control.
Is this antibody polyclonal or monoclonal, and what is its host species?
This is a rabbit polyclonal antibody of the IgG isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.