| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Bcl-xL (Phospho-Ser62) |
| available sizes | 100 µL |
rabbit anti-Bcl-xL (Phospho-Ser62) polyclonal antibody 9132
$366.00
Antibody summary
- Rabbit polyclonal to Bcl-xL (Phospho-Ser62)
- Suitable for: WB,IHC,IF
- Isotype: Whole IgG
- 100 µl
rabbit anti-Bcl-xL (Phospho-Ser62) polyclonal antibody 9132
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A ban of ~30kDa is detected. Immunohistochemistry: use at dilution of 1:50-1:100. Immunofluorescence: use at dilution of 1:100-1:200. These are recommended working dilutions. End user should determine optimal dilutions |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 62 derived from human Bcl-xL and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens BCL2L1 Bcl-2-like protein 1 |
| Protein names Bcl-2-like protein 1 |
| Alternative names Apoptosis regulator Bcl-X |
| Gene names BCL2L1 |
| Protein family Belongs to the Bcl-2 family |
| Function Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis |
| Subcellular location Mitochondrion inner membrane, Mitochondrion outer membrane, Mitochondrion matrix, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Cytoplasm, cytosol, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus membrane |
| Structure Forms heterodimers with BAX, BAK or BCL2; heterodimerization with BAX does not seem to be required for anti-apoptotic activity (PubMed:7644501). Interacts with isoform 1 of SIVA1; the interaction inhibits the anti-apoptotic activity (PubMed:12011449). Interacts with IKZF3 (PubMed:11714801). Interacts with RTL10/BOP (PubMed:23055042). Interacts with DNM1L and CLTA; DNM1L and BCL2L1 isoform BCL-X(L) may form a complex in synaptic vesicles that also contains clathrin and MFF (PubMed:23792689). Interacts (via the loop between motifs BH4 and BH3) with NLRP1 (via LRR repeats), but not with NLRP2, NLRP3, NLRP4, PYCARD, nor MEFV (PubMed:17418785). Interacts with BECN1 (PubMed:17337444, PubMed:22498477) |
| Post-translational modification Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity Phosphorylated on Ser-62 by CDK1. This phosphorylation is partial in normal mitotic cells, but complete in G2-arrested cells upon DNA-damage, thus promoting subsequent apoptosis probably by triggering caspases-mediated proteolysis. Phosphorylated by PLK3, leading to regulate the G2 checkpoint and progression to cytokinesis during mitosis. Phosphorylation at Ser-49 appears during the S phase and G2, disappears rapidly in early mitosis during prometaphase, metaphase and early anaphase, and re-appears during telophase and cytokinesis Ubiquitinated by RNF183 during prolonged ER stress, leading to degradation by the proteosome |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Endocytosis, Membrane, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Synapse, Transmembrane, Transmembrane helix, Ubl conjugation |
| Sequence MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
| UniProt accession: Q07817 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended dilution ranges for using the rabbit anti-Bcl-xL (Phospho-Ser62) polyclonal antibody in different applications?
For Western blotting, use the antibody at a dilution of 1:500 to 1:1,000, detecting a band of approximately 30 kDa. For immunohistochemistry, the recommended dilution is 1:50 to 1:100. For immunofluorescence, use at 1:100 to 1:200. These dilutions serve as guidelines, and optimal dilutions should be determined by the end user.
How should the rabbit anti-Bcl-xL (Phospho-Ser62) antibody be stored to ensure stability?
This antibody is supplied as a liquid at a concentration of 1 mg/mL in PBS buffer (without Mg2+ and Ca2+), pH 7.4, with 150 mM NaCl. It should be stored at -20°C and is stable for at least one year under these conditions.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.