| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Bcl-2 (Phospho-Thr56) |
| available sizes | 100 µL |
rabbit anti-Bcl-2 (Phospho-Thr56) polyclonal antibody 7588
$366.00
Antibody summary
- Rabbit polyclonal to Bcl-2 (Phospho-Thr56)
- Suitable for: IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-Bcl-2 (Phospho-Thr56) polyclonal antibody 7588
| antibody |
|---|
| Tested applications IHC,IHC |
| Recommended dilutions Immunohistochemistry: use at dilution of 1:50-1:100. These are recommended working dilutions. End user should determine optimal dilutions for their application. |
| Immunogen Peptide sequence that includes phosphorylation site of threonine 56 (G-H-T(p)-P-H) derived from human Bcl-2 and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens BCL2 Apoptosis regulator Bcl-2 |
| Protein names Apoptosis regulator Bcl-2 |
| Gene names BCL2 |
| Protein family Belongs to the Bcl-2 family |
| Function Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells (PubMed:1508712, PubMed:8183370). Regulates cell death by controlling the mitochondrial membrane permeability (PubMed:11368354). Appears to function in a feedback loop system with caspases (PubMed:11368354). Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PubMed:11368354). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function (PubMed:18570871, PubMed:20889974, PubMed:21358617). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785) |
| Subcellular location Mitochondrion outer membrane, Nucleus membrane, Endoplasmic reticulum membrane, Cytoplasm |
| Structure (Microbial infection) Interacts with Toxoplasma gondii ROP17; the interaction probably promotes BCL2 phosphorylation and degradation |
| Post-translational modification Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity (PubMed:11368354). Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle (PubMed:11368354). In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases (PubMed:11368354). Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-87, which stimulates starvation-induced autophagy (PubMed:10567572, PubMed:18570871). Dephosphorylated by protein phosphatase 2A (PP2A) (By similarity) Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity Monoubiquitinated by PRKN, leading to an increase in its stability (PubMed:20889974). Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome (PubMed:23431138). Ubiquitinated by XIAP, leading to its degradation by the proteasome (PubMed:29020630) |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Autophagy, Chromosomal rearrangement, Cytoplasm, Disease variant, Endoplasmic reticulum, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transmembrane, Transmembrane helix, Ubl conjugation |
| Sequence MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| UniProt accession: P10415 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-Bcl-2 (Phospho-Thr56) polyclonal antibody suitable for, and what dilution is recommended for immunohistochemistry?
This antibody is suitable for immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and Western blot (WB). For IHC applications, a recommended working dilution is between 1:50 and 1:100, but users should optimize the dilution for their specific experiments.
How should the rabbit anti-Bcl-2 (Phospho-Thr56) polyclonal antibody be stored to maintain its stability, and what is its concentration?
The antibody should be stored at -20°C to ensure stability for at least one year. It is provided as a liquid at a concentration of 1 mg/mL in PBS buffer without Mg2+ and Ca2+, pH 7.4, containing 150 mM NaCl.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.